(data stored in ACNUC7421 zone)

EMBL: CP001630.PE440

CP001630.PE440       Location/Qualifiers
FT   CDS_pept        483919..484830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0447"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mxa:MXAN_7294 putative
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34414"
FT                   /db_xref="GOA:C6WHW3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34414.1"
FT                   /translation="MTVHSGRSDTRTALAYLAPALLVLVGLLGYPVYQLVVISLFDYGQ
FT                   EQVSGGAPLTFLGLGNYAELLRDSRFWSVLGQTAGFAALCVAGTLLVGATLAVVATRVR
FT                   PWARALLFLTALGAWSTPAVAGSTIWLFLFDASFGFVNEALTALGVEGARDFPWLYGKW
FT                   TAFGVVAAEVVWCSFPFVMLTLYAGIRSIPGEVLEAAALDGASTWRAARSVVLPLLRPL
FT                   LVIVTIQSVIWDFKVFTQVYVMTSGGGIAGRNLVLAVHAYQQAFAASEYGMGAAIGVVT
FT                   TALLLLLTAGYLRALRRGGEPL"
     atgaccgtcc acagcggacg ctctgacacc cgcaccgccc tcgcctacct ggccccggcg        60
     ctgctggtcc tggtcggcct gctcggctac ccggtctacc agctcgtcgt catctccctg       120
     ttcgactacg gccaggagca ggtcagcggt ggcgcaccgc tcaccttcct cggcctcggc       180
     aactacgcgg aactcctgcg ggacagcagg ttctggtccg tgctcggcca gaccgccggg       240
     ttcgccgcgc tctgcgtcgc gggcaccctg ctggtcggcg cgacgctcgc cgtcgtcgcc       300
     accagggtcc gcccgtgggc ccgcgccctg ctgttcctga ccgcgctcgg cgcctggtcc       360
     accccggccg tcgcgggctc cacgatctgg ctgttcctgt tcgacgcgag cttcggcttc       420
     gtcaacgagg ccctcaccgc gctcggggtc gagggcgcgc gggacttccc gtggctgtac       480
     gggaagtgga ccgcgttcgg cgtcgtcgcc gccgaggtgg tctggtgctc gttcccgttc       540
     gtcatgctca ccctctacgc gggcatccgc tcgatccccg gcgaggtgct ggaggccgcc       600
     gcgctcgacg gggcctccac ctggcgcgcc gcccgcagcg tcgtgctgcc cctgctccgc       660
     ccgctgctgg tgatcgtcac catccagtcg gtcatctggg acttcaaggt cttcacccag       720
     gtctacgtca tgaccagcgg cggcggcatc gcgggccgca acctcgtgct cgccgtgcac       780
     gcctaccagc aggcgttcgc cgcctccgag tacgggatgg gcgcggcgat cggcgtcgtc       840
     accaccgcgc tgctgctcct gctcaccgcg ggctacctgc gggcgctgcg ccggggaggt       900
     gagccgctgt ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page