(data stored in ACNUC7421 zone)

EMBL: CP001630.PE441

CP001630.PE441       Location/Qualifiers
FT   CDS_pept        484827..485660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0448"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rlt:Rleg2_3667
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34415"
FT                   /db_xref="GOA:C6WHW4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34415.1"
FT                   /translation="MRRWAWEAVAVGASLVVAFPLYWMVLTALKPAAEVVSAEPRPWTL
FT                   APSPDSFTRALTVESFGRYLANSLVVAVAVVLLSLVVSFLAATALTRFRFKGRTTMLVM
FT                   LLVVQMVPVEALTIPLFFLVRQVGSAVPVLGLNHLGSLVLVHLAFSLPFAIWMLRGFVA
FT                   AVPVELEEAATLDGASRTRFLWRVLFPLVAPGLVATSALSFIHAWNDFLFAKTFIISAE
FT                   ENQTLPLALQVFVRPDQNDWGAIMAGSTLMTLPVLVFFVLVRRNLVGGLAGAVKS"
     gtgaggcgct gggcctggga ggcggtcgcg gtcggcgcgt cgctcgtcgt cgcgttcccg        60
     ctgtactgga tggtgctcac cgcgctcaag cccgccgccg aggtggtgtc ggccgagccg       120
     aggccgtgga cgctcgcccc gtcgccggac agcttcaccc gcgccctcac cgtcgagagc       180
     ttcggccgct acctggccaa cagcctcgtc gtcgcggtcg cggtggtgct gctgagcctg       240
     gtggtgtcgt tcctggccgc caccgcgctc acccggttcc gcttcaaggg gcgcaccacg       300
     atgctggtga tgctgctggt ggtgcagatg gtcccggtgg aggcgctgac catcccgctg       360
     ttcttcctgg tgcgccaggt ggggtcggcc gttcccgtgc tcgggctcaa ccacctcggc       420
     tcgctcgtgc tggtgcacct ggcgttcagc ctgccgttcg cgatctggat gctgcgcggc       480
     ttcgtcgcgg ccgtgccggt ggagctggag gaggcggcga ccctggacgg cgcgtcgcgg       540
     accaggttcc tgtggcgggt gctgttcccg ctggtggccc ccggactggt cgcgaccagc       600
     gcgctgtcgt tcatccacgc ctggaacgac ttcctgttcg ccaagacgtt catcatctcc       660
     gccgaggaga accagaccct gccgctcgcg ctccaggtgt tcgtgcggcc cgatcagaac       720
     gactgggggg cgatcatggc cggttccacc ctgatgacct tgccggtgct ggtgttcttc       780
     gtgctggtgc ggcgcaacct cgtcggcggc ctggccgggg cggtgaagtc gtga             834
//

If you have problems or comments...

PBIL Back to PBIL home page