(data stored in ACNUC7421 zone)

EMBL: CP001630.PE442

CP001630.PE442       Location/Qualifiers
FT   CDS_pept        485657..487000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0449"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: Glycoside hydrolase, family 20, catalytic
FT                   core; KEGG: nar:Saro_2417 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34416"
FT                   /db_xref="GOA:C6WHW5"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW5"
FT                   /inference="protein motif:PRIAM:3.2.1.52"
FT                   /protein_id="ACU34416.1"
FT                   /translation="MTLLPEPVSVVWGGGTVPWSTPVVRRAPGPAEGYRISISAGGVHV
FT                   DASDDAGEFYAHQTLRQLRGPDAFRAAPIRPDGPVPVCEIVDHPEHRWRGCMIDVARHF
FT                   LPKHDLLRYVDLLAAHKLNVLHLHLTDDQGWRVESERFPRLHEVGGWRPDSRWGDRRGG
FT                   LSTGRPHGGCYTRDDLREVVAYAAARHVTVVPEIDVPGHSQAAIAAYPELGVDGGGVWT
FT                   DWGVNPRVLNGSQSTVDFYRAVFDELLEVFPGEVVGFGGDEAPGGDGRFVRLIAEHLVA
FT                   RGRRPYGWDEVLDVEGLPEETVIAAWRSEEAVERALERGLDVVACPERHAYLDYRQSED
FT                   ADEPIPVGTVLTTEDVRAYRPVAGVLGAQANIWTEHLDSPRRLDYAAFPRLSAFAEVVW
FT                   NPAPVDGAGFAARLGAHLPRLAALGVEYRPPGGPLPWQRLPGVPGHPR"
     gtgacgctgc tgcccgagcc ggtgtcggtg gtctggggcg gggggaccgt gccgtggtcg        60
     acgccggtcg tgcggcgcgc gccaggaccg gccgagggct accggatctc catctccgcg       120
     ggcggcgtcc acgtcgacgc gtccgacgac gcgggcgagt tctacgccca ccagaccctg       180
     cgccagctgc gcggacccga cgcgttccgg gccgcgccga tccggccgga cgggcccgtg       240
     ccggtgtgcg agatcgtcga ccacccggag caccggtggc gcggctgcat gatcgacgtg       300
     gcgcggcact tcctgcccaa gcacgacctg ctgcggtacg tggacctgct ggccgcgcac       360
     aagctcaacg tgctgcacct gcacctgacc gacgaccagg gctggcgggt cgagtccgag       420
     cgcttcccga ggctgcacga ggtcggcggc tggcggccgg actcgcggtg gggcgaccgg       480
     cgcggcgggc tgagcaccgg gaggccgcac ggcgggtgct acacgcggga cgacctgcgc       540
     gaggtcgtgg cgtacgcggc ggcgcggcac gtgaccgtgg tgccggagat cgacgtgccg       600
     gggcactcgc aggcggccat cgcggcgtac ccggagctgg gcgtcgacgg cggcggggtg       660
     tggaccgact ggggggtgaa cccgcgcgtc ctcaacgggt cgcagtccac agtggacttc       720
     taccgcgcgg tgttcgacga gctgctggag gtgttccccg gcgaggtggt cggcttcggc       780
     ggcgacgagg cgccgggtgg cgacgggcgg ttcgtgcgcc tgatcgcgga gcacctcgtg       840
     gcgcgcgggc gcaggcccta cggctgggac gaggtgctgg acgtcgaggg gctgccggag       900
     gagacggtca tcgcggcgtg gcgctcggag gaggccgtgg agcgggcgct ggagcgcggg       960
     ctggacgtgg tcgcctgccc ggagcggcac gcgtacctgg actaccggca gtccgaggac      1020
     gcggacgagc cgatcccggt gggcacggtc ctcaccaccg aggacgtgcg cgcgtaccgg      1080
     ccggtggccg gggtgctcgg cgcgcaggcg aacatctgga ccgagcacct ggacagcccg      1140
     aggcgcctgg actacgccgc gttcccgagg ctctcggcgt tcgcggaggt ggtgtggaac      1200
     ccggccccgg tggacggggc cgggttcgcg gcgaggctgg gcgcgcacct gcccaggctc      1260
     gccgcgctcg gcgtcgagta ccggccgccg ggcggaccgc tgccgtggca gcgcctgcca      1320
     ggggtgcccg gtcacccgcg ctga                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page