(data stored in ACNUC7421 zone)

EMBL: CP001630.PE443

CP001630.PE443       Location/Qualifiers
FT   CDS_pept        complement(487001..487255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0450"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: cbc:CbuK_0644
FT                   stress-responsive transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34417"
FT                   /db_xref="GOA:C6WHW6"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW6"
FT                   /inference="protein motif:PFAM:PF04024"
FT                   /protein_id="ACU34417.1"
FT                   /translation="MTNNSLNDAAAKLGEATAQATTKVKQFRRSRTDRMIAGVCGGAAK
FT                   MLGIDAALLRILLVAATLFGVGAGAILYLAAWIFVPEEA"
     atgacgaaca actcgctcaa cgacgcagcc gccaagctcg gcgaggccac cgcgcaggcc        60
     accaccaagg tcaagcagtt ccgccgcagc cgcaccgacc gcatgatcgc cggcgtgtgc       120
     ggtggcgcgg cgaagatgct cggcatcgac gccgcgctgc tccgcatcct gctcgtcgcc       180
     gccacgctgt tcggcgtggg cgcgggcgcg atcctctacc tcgccgcgtg gatcttcgtg       240
     cccgaggagg cgtga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page