(data stored in ACNUC7421 zone)

EMBL: CP001630.PE444

CP001630.PE444       Location/Qualifiers
FT   CDS_pept        487494..488600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0451"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   msl:Msil_0236 protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34418"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW7"
FT                   /inference="protein motif:PFAM:PF02625"
FT                   /protein_id="ACU34418.1"
FT                   /translation="MRDVLPDLVRRVAAGEVVGVGTVVATFSSAPRPPGAAMLVGADGA
FT                   AVGSVSGGCVEGAVHELALGVVGGGAPVLRRFGVSDDDAFDVGLTCGGIIDVYVEAVSA
FT                   AGFPELPLVDASVRAGEAVAVATAVEHPTRAGARLVVWPDRVAGGLGSARVDDAVADDA
FT                   RGLLAAGRSGVLRYGPDGQRRGEGLSVFVNSFEPPPRLLVFGAIDFAAAMARLGAFLGY
FT                   RVTVCDARPVFATAARFPQADEVVVDWPHRYLAAEAAAGRVDRRTAVAVLTHDPKFDVP
FT                   LLEVALRLDLGYVGAMGSRRAHHDRTARLRAAGVGEAELGRLSSPIGLDLGARTPEETA
FT                   VSIAAEMIALRWGGGGARLTTTEGAIHR"
     gtgcgcgacg tgctccccga cctggtcaga cgggtcgccg ctggtgaggt ggtcggggtg        60
     gggacggtgg tcgccacgtt cagctccgcg ccacggccgc ccggcgcggc gatgctcgtg       120
     ggtgcggacg gcgccgccgt gggcagcgtg tccggggggt gcgtggaggg ggcggtgcac       180
     gagctggcgc tgggggtcgt cgggggcggg gcgccggtgc tgcggcggtt cggggtcagc       240
     gacgacgacg cgttcgacgt cgggctcacc tgcggcggga tcatcgacgt gtacgtcgag       300
     gcggtgtcgg cggccgggtt ccccgagctg ccgctggtcg acgcctcggt gcgggccggg       360
     gaggcggtgg ccgtcgcgac cgccgtcgag cacccgaccc gcgcgggcgc ccgcctggtc       420
     gtgtggccgg accgggtggc cggggggctc gggtcggcgc gggtggacga cgccgtggcc       480
     gacgacgcgc gcgggctgct cgcggcgggg cgcagcgggg tgctgcggta cgggccggac       540
     gggcagcggc ggggcgaggg gctgtcggtg ttcgtgaact ccttcgagcc gccgccgagg       600
     ctgctggtgt tcggcgcgat cgacttcgcc gccgcgatgg cccgcctcgg cgcgttcctg       660
     ggctaccgcg tgacggtctg cgacgcccgc ccggtcttcg cgaccgcggc ccgcttcccg       720
     caggcggacg aggtggtcgt cgactggccg caccgctacc tggccgccga ggcggcggcg       780
     gggcgggtcg accggcgcac ggcggtcgcg gtgctgacgc acgacccgaa gttcgacgtg       840
     cccctgctgg aggtcgccct gcggctcgac ctgggctacg tgggcgcgat gggctcgcgc       900
     cgcgcgcacc acgaccggac ggcccggctg cgggcggcgg gggtggggga ggcggagctg       960
     ggacggctgt cgtcgccgat cgggctggac ctgggggcgc ggacgccgga ggagacggcg      1020
     gtgtcgatcg cggcggagat gatcgcgttg cggtggggcg gagggggcgc gcggctgacc      1080
     acgaccgagg gggcgatcca ccggtga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page