(data stored in ACNUC7421 zone)

EMBL: CP001630.PE445

CP001630.PE445       Location/Qualifiers
FT   CDS_pept        489427..490365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0452"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bca:BCE_2879 mandelate racemase/muconate
FT                   lactonizing enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34419"
FT                   /db_xref="GOA:C6WHW8"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW8"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACU34419.1"
FT                   /translation="MLVYSIPMRTRFRGITVREGVLLEGERGWGEFCAFLDYSDAECAP
FT                   WLACAVEAAEEGWPAPVRERVAVNCTVPVVSPERAHALVSASGCGTAKVKVADPGAPLA
FT                   EDLERVAAVRDALGPGGAVRVDANAAWDVDTAVTAIRALDRAAGGLEYVEQPCRTVEEL
FT                   AAVRRRVDVRIAADESIRRAEDPLRVAVAGAADVAVIKVAPLGGVRRALRVAEACGLPC
FT                   VVSSAVETSVGMAAGLALAGALPELDFACGLGTLPLLDGDVATASLVPVDGWLPVPTAP
FT                   PVPDRAERFAADPETTLRWRERLARVGRPRG"
     gtgctcgtct actcgatccc catgcgcacc cggttccgcg gcatcaccgt ccgcgagggc        60
     gtgctgctgg agggcgagcg ggggtggggg gagttctgcg ccttcctcga ctactccgac       120
     gccgagtgcg ccccctggct cgcctgcgcc gtcgaggcgg ccgaggaggg gtggcccgcg       180
     ccggtgcgcg agcgggtcgc ggtgaactgc accgtgcccg tcgtgtcgcc cgagcgggcg       240
     cacgccctgg tctccgcctc cggctgcggc accgccaagg tcaaggtcgc cgaccccggc       300
     gcgccgctcg ccgaggacct cgaacgggtc gcggcggtgc gggacgcgct cgggcccggc       360
     ggcgccgtgc gggtcgacgc gaacgccgcc tgggacgtgg acaccgccgt cacggccatc       420
     cgggcgctcg accgcgccgc gggcggcctg gagtacgtcg agcagccctg ccgcaccgtc       480
     gaggagctgg ccgccgtgcg ccgccgcgtg gacgtgcgga tcgcggccga cgagtccatc       540
     cgccgcgccg aggaccccct gcgcgtcgcg gtcgcgggcg cggccgacgt cgcggtgatc       600
     aaggtcgcgc cgctgggcgg ggtccggcgg gcgctgcgcg tggccgaggc gtgcgggctg       660
     ccgtgcgtgg tgtcctcggc ggtggagacc tcggtcggca tggcggccgg gctcgcgctc       720
     gcgggcgcgc tgcccgagct ggacttcgcc tgcggcctcg gcaccctgcc cctgctcgac       780
     ggcgacgtcg ccaccgcctc gctcgtcccg gtcgacggct ggctcccggt cccgaccgcg       840
     cccccggtcc cggaccgcgc cgagcggttc gccgccgacc cggagaccac cctgcggtgg       900
     cgggagcgcc tcgcgcgggt cgggcgcccg cgcgggtga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page