(data stored in ACNUC7421 zone)

EMBL: CP001630.PE446

CP001630.PE446       Location/Qualifiers
FT   CDS_pept        complement(490565..492217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0453"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; KEGG: SSL2; DNA helicase; K10843
FT                   DNA excision repair protein ERCC-3"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34420"
FT                   /db_xref="GOA:C6WHW9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW9"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACU34420.1"
FT                   /translation="MTDGPLIVQSDKTLLLEVDHPAADEARAAIAPFAELERAPEHVHT
FT                   YRVTPLALWNARAAGHDAEQVVDALVRFSRYPVPQPLLVDVVDVMGRYGRLQLSTHPAH
FT                   GLVLQSLDRAVLEEVLRHKKIKPMFGARIDDDTVVVHASERGRLKQLLLKVGWPAEDLA
FT                   GYVDGEAHPIELVEEGWQLRDYQRLAAQAFRAGGSGVVVLPCGAGKTMVGAAAMAEAGA
FT                   TTLILVTNTVAGRQWKRELVARTSLTEDEIGEYSGERKEIRPVTIATYQVITRKSKGEY
FT                   KHLELFDSRDWGLIVYDEVHLLPAPVFRMTADLQSRRRLGLTATLVREDGQEGEVFSLI
FT                   GPKRFDVPWRDIEAQGWIAPAECTEVRVTLTDAERLGYATAEPEERYKLCSTARTKLPV
FT                   VKAVLDKHPGEPALVIGAYLDQLEELGEALGAPVVQGATKNKEREELFDAFRRGELSTL
FT                   VVSKVANFSIDLPEASVAVQVSGTFGSRQEEAQRLGRLLRPKADGRQAHFYSVVSRDTL
FT                   DTDYAAHRQRFLAEQGYAYRIVDADDLLGPKIG"
     gtgaccgacg gccccctgat cgtccagtcg gacaagaccc tgctgctgga ggtcgaccac        60
     ccggcggccg acgaggcgcg ggcggcgatc gctcccttcg ccgagctgga gcgggccccc       120
     gagcacgtgc acacctaccg ggtgacgccg ctggcgctgt ggaacgcgcg ggccgccggg       180
     cacgacgccg agcaggtcgt ggacgcgctg gtgcggttct cccgctaccc ggtgccgcag       240
     ccgctgctgg tggacgtggt cgacgtgatg ggccgctacg gcaggctcca gctcagcacg       300
     caccccgcgc acggcctggt gctccagtcg ctcgaccggg cggtgctgga ggaggtgctg       360
     cggcacaaga agatcaagcc gatgttcggc gcgcggatcg acgacgacac cgtcgtggtg       420
     cacgcgagcg agcggggcag gctcaagcag ctgctgctca aggtcggctg gcccgccgag       480
     gacctcgccg ggtacgtgga cggcgaggcc cacccgatcg agctggtcga ggagggctgg       540
     cagctgcgcg actaccagcg gctggccgcc caggcgttcc gggcgggcgg gtccggggtc       600
     gtggtgctgc cgtgcggcgc gggcaagacg atggtcggcg cggcggccat ggccgaggcc       660
     ggggcgacca cgctgatcct ggtgacgaac acggtcgccg ggcggcagtg gaagcgggag       720
     ctggtcgcgc ggacctcgct gaccgaggac gagatcggcg agtactcggg cgagcgcaag       780
     gagatccgcc cggtgacgat cgccacctac caggtgatca cccggaagtc gaagggcgag       840
     tacaagcacc tggagctgtt cgactcgcgg gactggggcc tgatcgtcta cgacgaggtg       900
     cacctgctgc ccgcgccggt gttccggatg accgccgacc tccagtcgcg gcggcggctg       960
     gggctgacgg cgacgctggt gcgcgaggac gggcaggagg gggaggtgtt ctccctgatc      1020
     gggcccaagc ggttcgacgt gccgtggcgg gacatcgagg cgcaggggtg gatcgcgccc      1080
     gccgagtgca ccgaggtgcg ggtgaccctg accgacgccg agcggctcgg gtacgcgacg      1140
     gcggagccgg aggagcggta caagttgtgc tcgacggcgc ggacgaagct gccggtggtg      1200
     aaggcggtgc tggacaagca ccccggcgag cccgcgctgg tgatcggcgc gtacctggac      1260
     cagctggagg agctgggcga ggcgctgggg gccccggtgg tgcagggggc gacgaagaac      1320
     aaggagcgcg aggagctgtt cgacgcgttc cggcgcgggg agctgagcac gctggtggtg      1380
     tcgaaggtcg cgaacttctc gatcgacctg ccggaggcgt ccgtggcggt gcaggtgtcg      1440
     gggacgttcg ggtcgcggca ggaggaggcg cagcggttgg ggcggttgct gcggccgaag      1500
     gcggacgggc gtcaggcgca cttctactcg gtggtctcgc gggacacgct cgacaccgat      1560
     tacgcggcgc accggcagcg gttcctggcg gagcagggtt acgcctatcg gatcgtggac      1620
     gcggatgatc ttctggggcc gaaaatcgga tga                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page