(data stored in ACNUC7421 zone)

EMBL: CP001630.PE447

CP001630.PE447       Location/Qualifiers
FT   CDS_pept        492343..492873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34421"
FT                   /db_xref="GOA:C6WHX0"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34421.1"
FT                   /translation="MSSDDARNDTGGKPAPNRRVLAIAAVAVVVLAVAGYAVHVLTGPG
FT                   SSAGECVRITGADGDSLAVTPDDCDADLANFRVGKVVDGADAPCPEEGVYTEARGQGSS
FT                   TLCLLPNMVEGACYGPDDRGFGGLVKSACAGEATIKVTKVIEGSTDTSGCPDGAGMSYP
FT                   EPPITFCVVPADL"
     atgagcagcg acgacgccag gaacgacacc ggcggcaagc ccgcgcccaa ccgcagggtc        60
     ctcgccatcg ccgccgtcgc ggtggtcgtc ctcgccgtcg ccgggtacgc cgtccacgtc       120
     ctcacgggcc ccggctcgtc ggcgggcgag tgcgtccgga tcaccggcgc ggacggcgac       180
     tcgctcgcgg tcacccccga cgactgcgac gcggacctgg ccaacttccg ggtcggcaag       240
     gtcgtggacg gcgccgacgc gccgtgcccc gaggagggcg tctacaccga ggcgcgcggc       300
     cagggctcca gcacgctctg cctgctgccg aacatggtcg agggcgcctg ctacggcccg       360
     gacgaccggg gcttcggcgg cctggtcaaa tccgcctgcg caggcgaggc gacgatcaag       420
     gtgaccaagg tcatcgaggg ctccaccgac acctccggct gcccggacgg cgcgggcatg       480
     tcctaccccg agccgcccat cacgttctgc gtcgtcccgg ccgacctgta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page