(data stored in ACNUC7421 zone)

EMBL: CP001630.PE448

CP001630.PE448       Location/Qualifiers
FT   CDS_pept        492929..493387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34422"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34422.1"
FT                   /translation="MRESGWLIGAAALVLAGGWLLAAPTAGEDLPSAGDCASFVGTADA
FT                   PGYAALDCGAEQANARVLGVADVADACPGSDARPTAGGAVCLGPNLVAGHCYRDDLQMG
FT                   LVRVTCDTFGAVKVLKVANSTFPCEEGDLLTLGDRSIAFCVTRAADSR"
     atgagagaga gcggatggct gatcggcgcg gcggcgctgg tcctggccgg gggctggctg        60
     ctggccgccc ccacggcggg tgaggacctg cccagcgcgg gcgactgcgc gagcttcgtc       120
     ggcacggcgg acgcccccgg ctacgcggcg ctggactgcg gggcggagca ggcgaacgcg       180
     cgggtgctcg gcgtcgccga cgtcgcggac gcctgccccg gttccgacgc gcggcccacg       240
     gcgggtggcg cggtgtgcct cggacccaac ctggtggcgg gtcactgcta ccgggacgac       300
     ctccagatgg gcctcgtccg agtgacgtgt gacacgtttg gggcggtcaa agtcctgaaa       360
     gtggcaaaca gcacatttcc gtgcgaagag ggtgatctgc tcaccctcgg cgaccgctcg       420
     atcgcgttct gcgtaacccg cgccgccgac tcgcggtag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page