(data stored in ACNUC7421 zone)

EMBL: CP001630.PE449

CP001630.PE449       Location/Qualifiers
FT   CDS_pept        493478..494566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Prp2; proline rich protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34423"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34423.1"
FT                   /translation="MTTPPEGPQDPWQPSWRPEPERRPEHSGPAVTPPQRAAQPVFPSQ
FT                   DAPWGAPTGHDRSPDPWPAARPAARPGAADPGPGPRHDPRTEPETPPTGLAQFGFTGEP
FT                   ADRSAFTVNGRISRKSEFAGQRDPARFPDFHRDERSAPPPSDDSLGYAVLVQPLGPGSA
FT                   PAPEVRYRQPWQPTHQEQHPHGPVPAHGTGLARRTKIVLALAAVVPLAAIVALSFGGED
FT                   RRTAVAGAEAGDCLKVNEVSRDGADVEMVDCAAGDAAYRVAVNLPETDRCPPGDYDEYI
FT                   RGGAGNRGFRLCLMLNATDGDCFKEEGGIAASKTTKVRCGSGATYKVAKAHSGTVDELV
FT                   CEFDENPRVYPTPPTTLCITDP"
     gtgaccacgc ccccagaagg cccgcaagac ccctggcagc cctcctggcg gccggagccc        60
     gagcggcggc cggagcactc cggaccggcc gtcaccccac ctcagcgggc cgctcagccc       120
     gtttttccct cccaggacgc cccctggggt gcgccgaccg gccacgaccg gtcccccgac       180
     ccctggcccg cagcccggcc cgcagcccgg cccggcgcgg ccgatccggg ccccggcccg       240
     cggcacgacc cgcggaccga gcccgagacc ccgccgaccg gcctcgcgca gttcgggttc       300
     accggcgaac cggcggaccg ctccgcgttc acagtgaatg gccggatttc caggaaatcg       360
     gaattcgcag gtcagcgcga ccccgcccga tttcccgatt tccaccgcga cgagcggtcg       420
     gcgccaccgc cgtccgacga ttccctgggt tacgccgtgc tcgtccaacc cctcggtccc       480
     ggcagcgcgc ctgcgcccga ggtccgctat cggcagccct ggcagcccac ccaccaggaa       540
     caacaccccc acggccccgt cccggcgcac gggaccggcc tggcgcgccg caccaaaatc       600
     gtgctcgccc tggccgccgt cgtccccctg gcggccatcg tggccctgtc gttcggcggc       660
     gaggaccgcc gcaccgccgt ggcgggcgcc gaggcgggag actgcctcaa ggtgaacgag       720
     gtcagccgtg acggggccga cgtggaaatg gtcgactgcg cggccgggga cgcggcgtac       780
     cgcgtcgccg tgaacctccc cgagaccgat cgctgcccgc ccggtgatta cgacgagtac       840
     atccgcggag gggcgggcaa caggggtttt cggctttgtc tgatgctgaa cgccacggac       900
     ggtgattgct tcaaggagga agggggcatc gccgccagca agaccacaaa ggtccgctgc       960
     ggctcgggag ccacctacaa ggtcgcaaag gcgcactcgg gcacggttga cgaactcgtc      1020
     tgcgaattcg acgagaaccc acgcgtctac ccgacgccgc cgaccaccct gtgcatcacc      1080
     gacccgtaa                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page