(data stored in ACNUC7421 zone)

EMBL: CP001630.PE45

CP001630.PE45        Location/Qualifiers
FT   CDS_pept        complement(49044..49484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34019"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34019.1"
FT                   /translation="MARRTARKRGISPSGAKNLVGVAKVVVPALLPVLAPLAARAASAA
FT                   GDRYDRYRAARLGVDVERLAEYSGRGARLHARISNAGAALAGLVDEDAGYAQRCQQRLA
FT                   QLQAAVRASEGMPAPRRKAAHRAVAADLDAVEGELLKRLGVD"
     atggcgcgga ggacggcgcg gaagcggggc atcagcccga gcggtgcgaa gaacctcgtc        60
     ggggtggcca aggtcgtggt gcccgcgctg ctcccggtgc tcgcgccgct ggccgcgcgc       120
     gcggcgtcgg cggcgggcga ccggtacgac cgctaccgcg cggccaggct gggcgtggac       180
     gtggagcggc tggccgagta ctccggccgg ggcgcccggc tgcacgcgcg gatctcgaac       240
     gcgggcgcgg cgctggccgg cctcgtggac gaggacgcgg gctacgcgca gcggtgccag       300
     cagcggttgg cccagctcca ggccgcggtg cgggcctccg aggggatgcc cgcaccacgc       360
     cggaaggcgg ctcaccgcgc cgtcgcggcc gatctggacg cggtggaggg cgagctgctg       420
     aagaggttgg gcgtcgacta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page