(data stored in ACNUC7421 zone)

EMBL: CP001630.PE450

CP001630.PE450       Location/Qualifiers
FT   CDS_pept        complement(494631..495632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0457"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems periplasmic components"
FT                   /note="KEGG: twin-arginine translocation pathway signal;
FT                   K02051 sulfonate/nitrate/taurine transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34424"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX3"
FT                   /inference="protein motif:COG:COG0715"
FT                   /protein_id="ACU34424.1"
FT                   /translation="MPTPARVLRRAAALIVCATTLSACGLLPGTSGDETPALERNTLRI
FT                   GVLPVVDVAPLKLALNDKLFERAGLQVQLVDVSSEDEGLKQLDSTLDITWGSHVKLFSK
FT                   VAEGTELQIQGEAYQAGANSMALVTTNPQYDSAEKIKARSANRKPKIAVDSTKDLGALT
FT                   TTSVLQTAGIQSSGVEMVTMPFSQMVNDLRADKVQAAWMIEPYITKAQREVGARVITDT
FT                   ATGPTQDFPMSGYASSKKFADANPQTLKLFRSVLQEAQQAASDDKLAVQDVLTSYIDVD
FT                   QQTAALVSIGTFPVSLNSVRLQRVADMMDTADVLVGKLDVQVLLPEGTASTG"
     atgcctaccc cagcgcgtgt tctccgtcgc gccgcagcgt tgatcgtctg cgcaacgacc        60
     ctgtcggcct gcggactgct gccgggtacc tccggggacg agacacccgc tctcgagcgc       120
     aacacgctca ggatcggggt cctgcccgtg gtcgacgtcg ctccgctcaa gctcgcgctc       180
     aacgacaagc tcttcgagcg cgccgggctc caggtccagc tggtggacgt gagcagcgaa       240
     gacgaaggcc tcaagcagct cgacagcacg ctcgacatca cgtggggcag ccacgtgaag       300
     ctgttcagca aggtcgcgga gggcaccgag ctccagatcc agggcgaggc ctaccaggcc       360
     ggggccaact cgatggccct ggtcaccacg aacccccagt acgacagcgc ggagaagatc       420
     aaggccaggt ccgcgaaccg gaagccgaag atcgccgtgg acagcaccaa ggacctcggc       480
     gcgctgacga cgacgtcggt gctccagacc gcgggcatcc agtcgtccgg cgtcgagatg       540
     gtcaccatgc cgttctcgca gatggtcaac gacctgcgcg cggacaaggt ccaggccgcc       600
     tggatgatcg agccgtacat caccaaggcc cagcgcgagg tcggcgcgcg cgtcatcacc       660
     gacaccgcca ccggccccac ccaggacttc cccatgtcgg gctacgcgtc gagcaagaag       720
     ttcgccgacg ccaacccgca gaccctcaag ctgttccgct cggtcctgca ggaggcccag       780
     caggccgcgt cggacgacaa gctggccgtc caggacgtcc tgaccagcta catcgacgtc       840
     gaccagcaga ccgcggcgct cgtgtcgatc ggcaccttcc cggtgtcgct caactcggtg       900
     cggctccagc gcgtcgcgga catgatggac accgccgacg tgctggtggg caagctggac       960
     gtgcaggtcc tgctgccgga gggaacggcc agcaccggct ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page