(data stored in ACNUC7421 zone)

EMBL: CP001630.PE451

CP001630.PE451       Location/Qualifiers
FT   CDS_pept        496042..499320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0458"
FT                   /product="putative sensor with HAMP domain"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; Nitrate and
FT                   nitrite sensing domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; KEGG: mag:amb3383 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34425"
FT                   /db_xref="GOA:C6WHX4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU34425.1"
FT                   /translation="MGDGLAALRDGTVTESTGTGLTTGVRQGEARTASWRLQNWRLPTK
FT                   LGAVLLIPTVAALALGGLRVQSDLANATQFSRLANQVQLETAVADLVHQLQRERDLSTW
FT                   YVASSKQIESVALDRQLVRVSDAVETLKSKIIDLSGDLAPETVERFRGTAEQLTRLNSL
FT                   RSAVRETQYPSDAVLRVYSESVESLLDLGEQAIGGIDDPELARLHLATNAMARIKEQES
FT                   QKRGILFDVFQRGSFAANQERALLAVNAELDAARNDFRKSATPDQAKIYDDTVTGLIID
FT                   TANNMQETALNLAGTTSGFGDISPKGWDVSSTLTVNKTRQVEVMLIEQLQRLSDERTGE
FT                   ARAAAFYDSGVVLGALLMALVMALFVARSILNPLRLLRRTALDVADKGLPEAVEKILAD
FT                   PNPQEAAKTAIAPVPITTREEVGQVARAFDAVHGEAVRLAAEQAMLRDNVNAMFVNLSR
FT                   RSQALVERQLNLIDRLEQDEQDPDQLASLFELDHLATRMRRNSENLLMLSGTDLSRRLT
FT                   RPVPVAEVLGAAVSEVEQYARVQVGQTPELTVQGRAVNDLVHLIAELLDNATAFSDPVT
FT                   KVTVRTARTRKGELAIEIQDRGVGMSDQDLRDANERLANPPDVDVAVSRRMGLYVVARL
FT                   AKRHDVKVRLRGNEDIEGGTTALVTVPEALVTSAGQTAHPMGADLIGSPSAPAPSAFPS
FT                   PNTAQRASGIAGAFGGGNGTAGVTSRHDEESSYPAVSFMSTDVDADATRAPYRAEVPQE
FT                   TSAEISQASWLPMVEEQPPAVARDAQNEPTGTFGSPTLFTAYEDRDAPQADHEHGYQTT
FT                   QFPAVDDSANAFAPFAAPLPEPEPEPEPEPEPEPVVFQRSSAPRASAPARPVVDDTPTE
FT                   RLPIYEAVLSQWFQSVGSETSAATTQAVPPAPAAPAPRPARQDVQPEPQREEAPLPTRK
FT                   PRPVSEQAQEAAAPSSAIENGLPKRQPGSQSNMSKRTLETSRVSEPEAVQAEPAAKASP
FT                   ASVWQSPADEGWQAAQSLLSSTPDATTQAGLPKRKPKAQLVPGSAAPLAGATQQPQQPP
FT                   LPPRSADVIRGRMSSLQQGVRRGRHALIDAYAGDMSSRQDEEQE"
     atgggtgacg gactggctgc gctgcgtgat ggaactgtga ctgaatcaac gggaaccggg        60
     ttgacgacag gcgtcaggca gggggaggcg cgcaccgcct cgtggcggct gcagaactgg       120
     cgcctgccca ccaagctggg ggctgtcctt ctcatcccga ccgtggcggc gctcgccctc       180
     ggcggtctgc gcgtgcagtc cgacctggcg aacgccacgc agttcagtcg actggccaac       240
     caggtgcagt tggagaccgc ggtcgcggac ctggtgcacc agctccagcg cgagcgcgac       300
     ctcagcacgt ggtatgtggc gtcgagcaag cagatcgaga gcgtcgcgct cgaccgccag       360
     ctcgtgcggg tgagcgacgc ggtcgagacg ctcaagagca agatcatcga cctgagcggg       420
     gacttggccc cggagacggt cgagcggttc cgcggcacgg ccgagcagct cacccggctg       480
     aacagcctgc gcagcgcggt ccgcgagacg cagtacccgt cagacgcggt cctgcgcgtc       540
     tactcggagt ccgtcgagag cctcctcgac cttggcgagc aggccatcgg tggcatcgac       600
     gaccccgagc tggcgaggct ccacctggcc acgaacgcga tggcccgcat caaggagcag       660
     gagtcgcaga agcgcggcat cctgttcgac gtcttccagc gcggcagctt cgcggccaac       720
     caggagcgcg ccctcctggc cgtcaacgcc gagctggacg cggcgcgcaa cgacttccgc       780
     aagtccgcca cgcccgacca ggccaagatc tacgacgaca ccgtcaccgg tctgatcatc       840
     gacacggcga acaacatgca ggagacggcg ctcaacctgg cggggaccac cagcgggttc       900
     ggcgacatca gccccaaggg ctgggacgtg tcctccaccc tgacggtcaa caagacccgc       960
     caggtggagg tcatgctcat cgagcagctg cagaggctga gcgacgagcg caccggcgag      1020
     gctcgcgccg cggcgttcta cgactccggc gtcgtgctcg gcgcgctgct catggccctc      1080
     gtcatggcgc tgttcgtcgc ccgctcgatc ctcaacccgc tgcgcctgct gcgccgcacg      1140
     gcgctcgacg tggcggacaa gggcctgccg gaggcggtcg agaagatcct cgccgacccg      1200
     aacccgcagg aggccgccaa gaccgccatc gcgccggtgc ccatcaccac gcgcgaagag      1260
     gtcggccagg tggcgcgggc gttcgacgcg gtgcacggcg aggcggtccg actggccgcc      1320
     gagcaggcga tgctccgcga caacgtcaac gccatgttcg tcaacctgtc ccgccggtcg      1380
     caggcgctcg tcgagcgcca gctgaacctg atcgaccggc tggagcagga cgagcaggac      1440
     ccggaccagc tcgccagcct gttcgagctg gaccacctcg cgacgcggat gcgccgcaac      1500
     agcgagaacc tgctgatgct ctcgggcacc gacctgtccc ggcggctcac ccgcccggtc      1560
     cccgtcgccg aggtcctcgg cgccgcggtg tccgaggtcg agcagtacgc cagggtccag      1620
     gtcggccaga ccccggagct caccgtccag ggccgcgcgg tcaacgacct cgtgcacctg      1680
     atcgcggagc tgctcgacaa cgcgaccgcg ttctccgacc cggtgaccaa ggtcaccgtg      1740
     cgcacggccc gcacccgcaa gggcgagctg gcgatcgaga tccaggaccg cggcgtcggc      1800
     atgagcgacc aggacctgcg cgacgccaac gagcggctgg ccaacccgcc ggacgtcgac      1860
     gtcgccgtct cccgccgcat gggcctgtac gtggtcgcgc ggctggccaa gcggcacgac      1920
     gtcaaggtca ggctccgggg caacgaggac atcgagggcg gcaccaccgc gctcgtcacc      1980
     gtccccgagg cgctggtcac ctcggccggt cagaccgccc acccgatggg cgcggacctg      2040
     atcggctcgc ccagcgcgcc tgccccgagc gccttcccga gcccgaacac cgcccagcgc      2100
     gccagcggca tcgcgggcgc cttcggcggc ggcaacggca cggcgggcgt caccagcagg      2160
     cacgacgagg agtccagcta cccggcggtc agcttcatgt cgaccgacgt ggacgccgac      2220
     gcgacccgcg cgccctaccg ggccgaggtg ccgcaggaga cctccgcgga gatctcccag      2280
     gcgtcctggc ttcccatggt cgaggagcag ccccccgcgg tggcgcggga cgcgcagaac      2340
     gagcccacgg gcacgttcgg ctcgcccacc ctcttcaccg cctacgagga ccgcgacgct      2400
     ccccaggcgg accacgagca cggctaccag accacccagt tcccggccgt ggacgactcg      2460
     gcgaacgcgt tcgcgccgtt cgccgcgccg ctgccggaac cggagccgga gccggagccc      2520
     gagcccgagc cggaaccggt cgtcttccag cgcagcagcg cacccagggc gtccgcgccc      2580
     gcgcggcccg tggtcgacga caccccgacg gaacgcctcc cgatctacga ggccgtcctg      2640
     tcgcagtggt tccagtccgt gggaagcgag acgtccgcgg cgaccaccca ggccgttccg      2700
     cccgccccgg ccgcacccgc tccgcgcccc gcgcggcagg atgtgcagcc ggaaccccag      2760
     cgggaggagg ctcctctgcc cacgcgcaag ccacgtccgg tgtcggagca ggcccaggaa      2820
     gccgccgccc cgagcagcgc catcgagaac ggtctgccca agcggcagcc cggttcgcag      2880
     agcaacatgt ccaagcgcac actggagacg agcagggtga gcgagccgga ggccgtccag      2940
     gccgaaccgg cggcaaaggc gagccccgcg tccgtctggc agtcgcccgc ggacgagggc      3000
     tggcaggccg cgcagtccct gctcagcagc acccccgacg ccacgacgca ggcagggctc      3060
     cccaagcgga agcccaaggc tcagcttgtg ccgggcagcg ccgcgcccct cgcgggcgcg      3120
     acgcagcaac cgcagcagcc cccgctgcca ccacgatcgg cagatgtcat tcgtggacgc      3180
     atgtcgagtc ttcagcaggg cgtccgtcgg gggcggcacg cgctgatcga cgcttacgct      3240
     ggtgacatgt cgagccggca agacgaggag caggagtga                             3279
//

If you have problems or comments...

PBIL Back to PBIL home page