(data stored in ACNUC7421 zone)

EMBL: CP001630.PE452

CP001630.PE452       Location/Qualifiers
FT   CDS_pept        499317..499736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0459"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   pna:Pnap_2813 roadblock/LC7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34426"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX5"
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /protein_id="ACU34426.1"
FT                   /translation="MTTAAQPGSFGWLITDFVRRVPGVAHSVVVSADGLLLAGSQGLPR
FT                   DRAEQLSAVASGLVSLTTGAARCFEAGTVNQTVVEMERGYLFLMSISDGSCLAVLAAPN
FT                   CDIGLVAYEMTLLVERVGQQLTPELRAQLQGVVRR"
     gtgacgaccg cagctcagcc aggaagcttt ggttggctta tcaccgactt cgtgcgtcgg        60
     gttcccggcg tcgcgcattc cgttgtggtg tcggcggacg ggcttctgct cgccggctcc       120
     cagggactgc cgagggaccg cgccgagcag ctctccgctg tggcctctgg cctggtgagc       180
     ctcaccacag gcgccgccag gtgcttcgag gcgggcacgg tgaaccagac cgtggtggag       240
     atggagcggg gctacctgtt cctgatgtcc atcagcgacg gctcctgcct cgcggtgctc       300
     gcagccccga actgcgacat cggtctggtc gcctacgaga tgaccctgct ggtcgagcga       360
     gtcggccagc agctcacccc ggagctgcgc gcgcagctcc agggcgtggt tcggcggtag       420
//

If you have problems or comments...

PBIL Back to PBIL home page