(data stored in ACNUC7421 zone)

EMBL: CP001630.PE453

CP001630.PE453       Location/Qualifiers
FT   CDS_pept        499962..500510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0460"
FT                   /product="protein of unknown function DUF742"
FT                   /note="PFAM: protein of unknown function DUF742"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34427"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX6"
FT                   /inference="protein motif:PFAM:PF05331"
FT                   /protein_id="ACU34427.1"
FT                   /translation="MAQREVEDSSYDYDDVPNRFDIDGYGSGLFGGPGADLFGAHGLPE
FT                   SVPEQLPYTTGPQPVVRQEEHPAAESGSLVRPYTRTGGRTRPDYDLAIEALISTSERGL
FT                   ERDAAVLPEHRSICGLCTDTRSVAEVAALLRLPLGVARVLIGDMASMGLVLIHQGGMVV
FT                   GDKPSIDFLERVLSGLRRL"
     atggctcagc gtgaggttga agactcgtcg tacgactacg acgacgttcc caaccgattc        60
     gacatcgacg ggtacggcag cggcctgttc ggaggtccgg gtgccgacct gttcggtgcc       120
     cacggcttgc ccgagagcgt gccggagcag ctcccgtaca caaccggacc tcagccggtc       180
     gtgcgacagg aggagcaccc ggcggccgaa tcaggctcgt tggtccgccc gtacacccgg       240
     accggcggcc gaacccggcc tgactacgac ctggcgatcg aggcgctgat ctccaccagc       300
     gaacgaggac tcgagcgcga cgcggcggtg ctccccgagc accgctccat ctgcgggctg       360
     tgcaccgaca ccaggtcggt ggccgaggtc gccgcgctgc tccggcttcc gctgggcgtg       420
     gcgcgagtgc tcatcggcga catggccagc atgggtttgg ttttgattca ccagggcggc       480
     atggttgtgg gggacaagcc gtccatcgat ttccttgaga gggtgctcag tgggcttcgc       540
     aggctctag                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page