(data stored in ACNUC7421 zone)

EMBL: CP001630.PE454

CP001630.PE454       Location/Qualifiers
FT   CDS_pept        500491..501099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0461"
FT                   /product="protein of unknown function ATP binding"
FT                   /note="PFAM: protein of unknown function ATP binding; KEGG:
FT                   nmn:NMCC_1665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34428"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX7"
FT                   /inference="protein motif:PFAM:PF03029"
FT                   /protein_id="ACU34428.1"
FT                   /translation="MGFAGSSPNAAAEGARKPTTSAKIVVAGGFGVGKTTFVGSVSEIV
FT                   PLTTEAVMTEASAGVDDLSATPNKVTTTVAMDFGRVSLDSDLILYLFGTPGQHRFWFMW
FT                   DDLVRGAIGAIVLVDTRRLADAFASIDFFDDRQLPYVVGVNCFDGLLHHRIEDVREALT
FT                   IDQSVPIVTCDARNRQSTKQTLITLVEHAMRQWMSVRAG"
     gtgggcttcg caggctctag ccccaacgcc gccgcagaag gcgcacggaa gcctacgacc        60
     tccgcgaaga tcgtggtggc cggcggcttc ggcgtgggca agacgacgtt cgtcggctcc       120
     gtgtcggaga tcgtgccgct gaccaccgag gcggtgatga cggaggccag tgcgggggtc       180
     gacgacctct ccgcaacgcc caacaaggtc accaccacgg tcgcgatgga cttcggccga       240
     gtctcgttgg acagcgacct gatcctgtac ctgttcggta cgcccggtca gcaccgcttc       300
     tggttcatgt gggacgacct cgtgcggggc gccatcggcg ccatcgtgct ggtcgacacc       360
     cgcaggctgg ccgacgcgtt cgcttcgatc gacttcttcg acgaccggca gctgccgtac       420
     gtcgtcgggg tcaactgctt cgacggtctg ctccaccacc gcatcgagga cgtccgcgag       480
     gcactgacga tcgaccagtc ggtcccgatc gtcacctgcg acgcccgcaa ccggcagtcg       540
     accaagcaga cgctcatcac gctggtcgag cacgcgatgc gtcagtggat gtccgttcgc       600
     gcgggctga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page