(data stored in ACNUC7421 zone)

EMBL: CP001630.PE455

CP001630.PE455       Location/Qualifiers
FT   CDS_pept        complement(501188..502924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_2082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34429"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34429.1"
FT                   /translation="MAIFRRGALVLAVAAATCAFSAGNALATPVAPEASTGAEAERTAP
FT                   GATERLLDLDGDIDLSLSLGGDDHWCHWWTLDDLQDVLGDSPVWSVGDLEDLLDGTTVV
FT                   LDPSDLDDLFDNVLDHTHAVDVDDLLGGNGLLGDIDLDVDAVLGSGGGLLDLGDLLGDG
FT                   DLLGDDLLDLDAVLDLDLNSGNDGLLGGLLGDGDGLLGIDGLLDDGLLDLDAVLDLDLD
FT                   GLLDLDDLLDIDLDADVDADLSIGGGNDGVIVLPGTGSGSGLPSLPGVSGGDSTSGGDT
FT                   APGTVVPGATLPGAVTGLPGTVTDTVEDVTDAVGGIGEVAGDAGEVAGDLTDTAGDIVS
FT                   GAGDLVSGAGDIVDTATTGVQDVLSGASNAVTSATDLASSIAQAATNPITSIAGSNPAT
FT                   APTLPAVTAPTAPVASNPLGTVTSAVGSVLGSVKPVTATVSGSGSLTGSLTGGDSKEGV
FT                   PAQQQPVEQAVEAVQPAVAEVAPAATDIVMTTTAAPMAEAQEDVTEVASDGRLSAAEWL
FT                   WLIHHHDNDGLLGDLLDDLLGLDLDIDADVDLDLGGHGHGGLLGLGGHHGGLLGGLLNI
FT                   GG"
     atggcgatct tccgaagggg agcgctcgtg ctcgcggttg ccgccgcgac atgtgccttc        60
     tccgccggca acgccctggc cacacccgtc gcccctgagg cgtcgaccgg ggccgaggcc       120
     gagcggaccg cgcccggtgc caccgagcgc ctgctcgacc tggacgggga catcgacctg       180
     tccctgtcgc tcggcggtga cgaccactgg tgccactggt ggaccctgga cgacctgcag       240
     gacgtgctcg gcgactcgcc cgtgtggtcc gtcggagacc tggaagacct gctcgacggc       300
     accacggtcg tgctcgaccc gtccgacctg gacgacctgt tcgacaacgt gctcgaccac       360
     acccacgcgg tggacgtgga cgacctgctc ggcggcaacg gcctgctggg cgacatcgac       420
     ctggacgtcg acgccgtgct cggctcgggc ggcggcctgc tcgacctggg cgacctgctc       480
     ggcgacggcg acctgctcgg cgacgacctg ctcgacctgg acgcggtcct cgacctcgac       540
     ctgaacagcg ggaacgacgg cctcctcggc ggcctgctcg gtgacggcga cggcctgctc       600
     ggcatcgacg gcctgctgga cgacggcctg ctcgacctgg acgcggtcct cgacctcgac       660
     ctcgacggcc tgctcgacct ggacgacctg ctcgacatcg acctggacgc cgacgtcgac       720
     gccgacctca gcatcggtgg cggcaacgac ggcgtgatcg tgctccccgg caccggctcg       780
     ggctccggcc tgccgagcct gcccggcgtc agcggcggtg acagcaccag cggtggcgac       840
     accgcgccgg gcaccgtcgt gcccggcgcc acgctgcccg gcgccgtcac cggcctgccc       900
     ggcaccgtca ccgacaccgt cgaggacgtg accgacgcgg tcggcggcat cggcgaggtc       960
     gccggtgacg cgggcgaggt cgcgggcgac ctgaccgaca ccgcgggcga catcgtgtcc      1020
     ggcgcgggcg acctggtctc cggcgcgggc gacatcgtcg acaccgccac caccggtgtg      1080
     caggacgtgc tctcgggcgc gagcaacgcc gtgaccagcg cgaccgacct ggccagcagc      1140
     atcgcccagg ccgcgaccaa cccgatcacc tcgatcgcgg gctcgaaccc ggccaccgcg      1200
     ccgaccctgc ccgccgtcac cgcgccgacc gccccggtcg cgtccaaccc gctcggcacc      1260
     gtgacgagcg ccgtcggctc ggtcctgggc tcggtcaagc ccgtcaccgc caccgtgtcc      1320
     ggcagcggct cgctgaccgg ctcgctgacc ggcggcgact ccaaggaggg cgtccccgcc      1380
     cagcagcagc cggtggagca ggccgtggag gccgtgcagc ccgccgtcgc cgaggtcgcg      1440
     cccgccgcga ccgacatcgt gatgaccacc accgccgccc cgatggccga ggcgcaggag      1500
     gacgtcaccg aggtcgcctc cgacggcagg ctgagcgccg ccgagtggct gtggctgatc      1560
     caccaccacg acaacgacgg tctgctgggc gacctgctcg acgacctgct gggtctcgac      1620
     ctggacatcg acgccgacgt cgacctcgac ctcggtggcc acggccacgg cggtctgctg      1680
     ggtctgggcg gccaccacgg cggcctgctc ggcgggctgc tgaacatcgg cggctga         1737
//

If you have problems or comments...

PBIL Back to PBIL home page