(data stored in ACNUC7421 zone)

EMBL: CP001630.PE456

CP001630.PE456       Location/Qualifiers
FT   CDS_pept        complement(503041..505284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_2891 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34430"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34430.1"
FT                   /translation="MSGTTLADWLRAQDDKVLVALLRARPDLATPPPADTSVLATRLGS
FT                   RSSVARACEDLDSLALTALEALLVLDADRAPVPISALRALFKPHRVTVARPVALLRSRG
FT                   LLWGPDSALRVPASARDAVSPFPCGLGRSAPSLADVDLSGLDEGESRVLAALATGRPTG
FT                   QTKDAAHVVSLERATSPIQKLLARGLLVRRDQSTVELPREVGLAVRGDRPLGDVVAEEP
FT                   ALRTQALDPGRVDGTGAGAVLELVRHVEGLVGSWSQEPPAVLRSGGLGVRELRRVAKDL
FT                   DVTEERAALLVELAVAAGLVGDSAGLEPEWVPTAQADPWLAAGPEQRWAVLAQAWLELG
FT                   RLPGLVGGRDDRDRPLNPLAPELARAAAPKDRRRVLEALAELEPGTAVPDVAGLAATLA
FT                   WRAPRRGGRLRDELVRWTVEEGTALGVLALGAATGAGRALLGEGAAAAAKRLADALPDP
FT                   VDHVLVQADLTVVAPGRLEPELAGEMALVADVESAGHATVYRVDERTVRRALDSGRTAD
FT                   DLHELFRSRSRTPVPQSLTYLVDDTARKHGRLRGGPAGSFLRCDDPVLVAEVLAHPASD
FT                   ALELRRIAPTVLVSPLPLAEVLAGLRGAGFAPVAEDAGGQVVDLRAGGRRITGRGRRKS
FT                   PPPPTASPEQLAELVRQLRAGDRAATTTAGARVTVPGNLGSGPSVTLAVLQQAAREGGE
FT                   VLVDFVDGHGTAASRVIKPQVVGGGVLEGVDVGYGEVRRFPLHRITSVAIVHK"
     atgtccggca ccacactcgc cgactggctg cgcgcccagg acgacaaggt cctggtcgcg        60
     ctgctgcgcg cacgccccga cctggccact cccccgcccg ccgacacctc ggtcctggcc       120
     acccggctgg ggtcccgctc ctcggtcgcg cgggcctgcg aggacctgga ctcgctggcg       180
     ctgaccgcgc tggaggcgct gctggtgctg gacgccgacc gcgccccggt cccgatctcc       240
     gcgctgcgcg ccctgttcaa gccgcaccgg gtgacggtcg cccgaccggt ggcgctgctg       300
     cgctcgcgcg ggctgctgtg gggcccggac tcggcgctgc gcgtcccggc ctcggcccgc       360
     gacgcggtct cgccgttccc gtgcggcctc ggccgttcgg cgccgtcgct ggcggacgtg       420
     gacctgtccg ggctggacga gggcgagtcg cgggtgctgg ccgcgctggc gaccgggcgg       480
     ccgaccggcc agaccaagga cgccgcgcac gtggtgtcgc tggagcgggc gaccagcccc       540
     atccagaagc tgctcgcgcg cggcctgctg gtgcgtcgcg accagtccac cgtggagctg       600
     ccccgcgagg tggggctggc cgtgcgcggc gaccggccgc tcggggacgt ggtcgccgag       660
     gagcccgcgc tgcgcaccca ggcgctcgac cccggccggg tggacggcac cggcgcgggc       720
     gcggtgctgg agctggtccg gcacgtggag gggctggtcg ggtcctggtc gcaggagccg       780
     cccgccgtgc tgcgctccgg cgggctgggc gtgcgcgagc tgcgccgggt ggccaaggac       840
     ctggacgtga ccgaggagcg ggccgcgctg ctggtggagc tggcggtggc cgcgggcctg       900
     gtcggcgaca gcgcgggcct ggagccggag tgggtgccga ccgcgcaggc cgacccgtgg       960
     ctggccgccg ggcccgagca gcgctgggcg gtgctcgcgc aggcgtggct ggagctgggc      1020
     aggctgccgg ggctggtcgg cgggcgcgac gaccgcgacc ggccgctgaa cccgctggcc      1080
     cccgagctgg cgcgggccgc cgcgcccaag gaccgcaggc gggtgctgga ggcgctggcc      1140
     gagctggagc cgggcaccgc cgtgccggac gtggccgggc tggccgcgac gctggcctgg      1200
     cgggcgcccc gccgcggcgg gaggctgcgc gacgagctgg tgcgctggac cgtcgaggag      1260
     ggcaccgcgc tgggcgtgct cgcgctcggc gcggcgaccg gcgcgggtcg cgcgctgctc      1320
     ggcgagggcg cggcggcggc ggcgaagcgg ctggccgacg cgctgcccga cccggtcgac      1380
     cacgtgctcg tgcaggccga cctgaccgtg gtggcccccg gcaggctgga gccggagctg      1440
     gccggggaga tggcgctggt cgccgacgtc gagtcggccg gtcacgccac cgtgtaccgg      1500
     gtggacgagc ggaccgtgcg gcgggcgctc gactccgggc gcaccgccga cgacctgcac      1560
     gagctgttcc gctcgcgctc ccgcacgccg gtcccccagt cgctgaccta cctggtggac      1620
     gacaccgccc gcaagcacgg gcggctgcgc ggcggccccg ccgggtcgtt cctgcgctgc      1680
     gacgacccgg tgctggtggc cgaggtgctc gcgcaccccg cgtcggacgc gctggagctg      1740
     cgccggatcg cgccgaccgt gctggtgtcg ccgctgccgc tggccgaggt gctggccggg      1800
     ctgcgcggcg cgggcttcgc gccggtcgcc gaggacgcgg gcgggcaggt ggtcgacctg      1860
     cgggcgggcg ggcggcggat caccggccgg ggcaggcgga agtcgccgcc ccctccgacg      1920
     gcctcgccgg agcagctggc ggagctcgtc cggcagctcc gagcgggtga tcgggcggcc      1980
     acgactaccg cgggtgcacg ggtgacggtt ccagggaacc tcggatcggg gccgtcggtg      2040
     accctggcgg tgctccagca ggccgcccga gagggtggcg aggtgctggt ggacttcgtg      2100
     gacgggcacg gcaccgccgc cagccgggtg ataaagccgc aggtggtggg tggtggagtc      2160
     ctggaagggg tggacgtcgg ctacggagag gtgcggcgct tcccgctgca ccggatcacc      2220
     tcggtggcga tcgtccacaa gtga                                             2244
//

If you have problems or comments...

PBIL Back to PBIL home page