(data stored in ACNUC7421 zone)

EMBL: CP001630.PE457

CP001630.PE457       Location/Qualifiers
FT   CDS_pept        505350..505535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34431"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34431.1"
FT                   /translation="MAKARPERIDPQWPEAPAGHKHAVSELASDVQGALSPFGGTAFPQ
FT                   PLEELGYHHPSTTINR"
     gtggccaagg cccgcccgga gcgaatcgac ccccaatggc cggaggcgcc cgccggccac        60
     aagcacgccg tgagcgagct ggccagcgac gtgcagggcg cgctgtcccc gttcggcggc       120
     accgccttcc cccagccgct ggaggagctc ggctaccacc acccgagcac cacgatcaac       180
     cgctag                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page