(data stored in ACNUC7421 zone)

EMBL: CP001630.PE458

CP001630.PE458       Location/Qualifiers
FT   CDS_pept        505641..507044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0465"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; KEGG: sat:SYN_00517 NAD-dependent malic
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34432"
FT                   /db_xref="GOA:C6WHY1"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY1"
FT                   /inference="protein motif:PRIAM:1.1.1.38"
FT                   /protein_id="ACU34432.1"
FT                   /translation="MPVPGPGYSITVRLEAPPSASAAGDLTSAVGRAGGVITAFDVVES
FT                   HNDRVIIDLTCNALSANHAKDITDTLEQLPGIVVRKVSDRTFLVHLGGKIEISSKVPLR
FT                   NRDDLSRAYTPGVARVCQAIAENPEDARRLTIKRNTVAVVTDGSAVLGLGNLGPAAALP
FT                   VMEGKAALFKKFAGVDAWPVCLDTQDTEEIIRAVELIAPVYGGINLEDIAAPRCFEIEA
FT                   RLREKLDIPVFHDDQHGTAIVVVGALRNALRVVGKDISECKIVVCGVGAAGSAIIRLLL
FT                   KQTPGDVVAVDVDGIVHRDRPGMDPNLASVAESTNKENVSGRLHDALVGADVFIGVSAP
FT                   NLFGAEQVATMNSDAIVFALANPDPEIDPMEAQKHAAVVATGRSDFPNQINNVLAFPGV
FT                   FRGLLDANANTITDEMLLAAATAIADVVDGDRLNASFIVPSVFDTTVAPAVAEAVRKVA
FT                   SELKAAERA"
     atgccggtcc ccggccctgg ttactcgatc accgttcgcc tggaggcgcc gccctcggcg        60
     agcgctgcgg gagacctgac ctccgccgtc ggccgggctg gtggcgtcat caccgcgttc       120
     gacgtcgtgg agtcccacaa cgaccgggtg atcatcgacc tcacctgcaa cgcgctgtcc       180
     gcgaaccacg ccaaggacat caccgacacc ctggagcagc tgccggggat cgtcgtgcgc       240
     aaggtctccg accggacctt cctggtccac ctcggcggca agatcgagat ctcgtcgaag       300
     gtgccgctgc gcaaccgcga cgacctctcc cgcgcctaca cgcccggcgt cgcccgcgtg       360
     tgccaggcca tcgcggagaa ccccgaggac gcgcgccgcc tcaccatcaa gcgcaacacc       420
     gtggcggtcg tcacggacgg ctccgccgtg ctgggcctgg gcaacctcgg ccccgccgcc       480
     gcgctgccgg tgatggaggg caaggccgcg ctgttcaaga agttcgcggg cgtcgacgcc       540
     tggccggtct gcctggacac ccaggacacc gaggagatca tccgcgccgt cgagctgatc       600
     gcccccgtgt acggcggcat caacctggag gacatcgccg cgccgcgctg cttcgagatc       660
     gaggcccggc tgcgggagaa gctcgacatc ccggtgttcc acgacgacca gcacggcacg       720
     gcgatcgtcg tcgtcggcgc cctgcgcaac gcgctgcgcg tggtcggcaa ggacatctcc       780
     gagtgcaaga tcgtggtctg cggcgtcggc gcggcgggct cggcgatcat ccgcctgctg       840
     ctcaagcaga cccccggcga cgtcgtcgcg gtcgacgtgg acggcatcgt gcaccgcgac       900
     cggccgggca tggacccgaa cctggcgtcc gtcgcggaga gcacgaacaa ggagaacgtc       960
     tccggcaggc tgcacgacgc gctcgtgggc gcggacgtgt tcatcggcgt ctccgcgccg      1020
     aacctgttcg gcgccgagca ggtcgcgacc atgaacagcg acgcgatcgt gttcgcgctg      1080
     gccaacccgg acccggagat cgacccgatg gaggcgcaga agcacgccgc cgtcgtggcc      1140
     accgggcgca gcgacttccc gaaccagatc aacaacgtcc tggcgttccc cggcgtgttc      1200
     cgggggctgc tcgacgcgaa cgccaacacc atcaccgacg agatgctgct ggccgccgcc      1260
     acggcgatcg cggacgtggt ggacggggac cggctgaacg cgtcgttcat cgtgccgagc      1320
     gtgttcgaca ccacggtcgc gcccgccgtc gcggaggccg tgcgcaaggt cgcgtccgag      1380
     ctgaaggcgg ccgagcgggc ctga                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page