(data stored in ACNUC7421 zone)

EMBL: CP001630.PE459

CP001630.PE459       Location/Qualifiers
FT   CDS_pept        507285..507758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0466"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: eli:ELI_06520 molybdopterin cofactor biosynthesis
FT                   MoaC region"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34433"
FT                   /db_xref="GOA:C6WHY2"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY2"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ACU34433.1"
FT                   /translation="MSQFTHIDASGAARMVDVTDKPATARTAVATGVLRTTAEVVRLLA
FT                   ADDLPKGDALATARIAGIMAAKRTSELVPLCHPIALSGVKVDLELGEAEVRVTATVRTA
FT                   DRTGVEMEALTAVSVAGLALHDMVKAVDPAASMDAVRVERKEGGKTGLWERPA"
     atgagccagt tcacccacat cgatgcgagc ggcgcggcgc gcatggtcga cgtcaccgac        60
     aagccggcca ccgcccgcac cgccgtggcc accggggtgc tgcgcaccac ggccgaggtc       120
     gtgcgcctgc tggccgccga cgacctgccc aagggcgacg cgctggccac cgcccgcatc       180
     gccgggatca tggccgccaa gcgcacctcg gagctggtgc cgctgtgcca ccccatcgcg       240
     ctgtcgggcg tcaaggtcga cctggagctg ggcgaggccg aggtgcgggt caccgcgacc       300
     gtgcgcaccg ccgaccggac cggcgtggag atggaggcgc tgaccgcagt gtccgtcgcc       360
     gggctcgcgc tgcacgacat ggtgaaggcc gtcgacccgg ccgcgagcat ggacgcggtg       420
     cgggtcgagc gcaaggaggg cggcaagacc ggcctgtggg agcgccccgc gtga             474
//

If you have problems or comments...

PBIL Back to PBIL home page