(data stored in ACNUC7421 zone)

EMBL: CP001630.PE46

CP001630.PE46        Location/Qualifiers
FT   CDS_pept        49586..51220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0046"
FT                   /product="nuclease (RecB family)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34020"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ9"
FT                   /inference="protein motif:COG:COG2251"
FT                   /protein_id="ACU34020.1"
FT                   /translation="MTSQVQLDAGVVTRCRRRVHLEHDPDVREAAKAPPDAAGQQRRAD
FT                   AVDHRAAVARALGREVGSALVEVPPDVPVADRERVTAEAMRVGAEYIWGAVLPRDPRGG
FT                   RKGGVELLVRDRTGYVPVIVVRHKTTDPGHGARTSPLSYPQPAGARTDPVRKVRPQPRD
FT                   QLRLAHVQRLLQASGHAAPGRATGGAIGMDADVVVWHDLEAATWPGGRTALSEYDARFA
FT                   DRLAIADAAIAGTSPLARPSRVVECKTCPWWPVCSDALTQARDVSLVVRGEDAMALRRA
FT                   GVPTVDDLAALDPAEPAVPLVGMAHEDAVVLARAWLRGLAVARRVPRIEVARAEVEVDV
FT                   DMESFGDLGAYMWGCLLSGADVGVEPGYRAFATWDKLPCADEARSFAEFWAWLTGVRRA
FT                   AAERGLGFKAYCYNELAENRWLLSSAQRFKGQPGVPPVAEVKEFITSDDWVDLFGVVRD
FT                   QFLSTNGKGLKTIAPLAGFHWRDPEAGGENSMRWYRDAVGMDGQEPDPAQRRRLLEYNE
FT                   DDVRATHALRGWMTSDAVAGLPYAGDL"
     gtgacttccc aggtgcagct cgacgccggt gtggtcactc gttgccggcg gcgggtgcac        60
     ctcgaacacg acccggacgt gcgggaggcc gccaaggccc cgccggacgc cgccgggcag       120
     cagcgccggg ccgacgcggt ggaccaccgg gccgccgtcg ccagggcgct cggccgcgag       180
     gtcggctcgg ccctcgtcga agttcccccg gacgtgcccg tcgcggaccg cgagcgggtc       240
     accgccgagg cgatgcgggt gggcgccgag tacatctggg gcgcggtgct gccgcgcgac       300
     ccgcgcggtg gccgcaaggg cggcgtcgag ctgctggtcc gcgaccgcac cgggtacgtg       360
     ccggtgatcg tcgtgcggca caagaccacc gaccccggcc acggggcccg cacctccccg       420
     ctgtcctacc cgcagcccgc gggcgcgcgc accgacccgg tgcgcaaggt ccgcccccag       480
     ccgcgcgacc agctgcgcct cgcgcacgtc cagcggctcc tgcaggcctc gggccacgcg       540
     gcccccggcc gggccaccgg cggcgccatc ggcatggacg ccgacgtcgt ggtgtggcac       600
     gacctcgagg cggcgacctg gccgggcggg cgcaccgcgc tgtccgagta cgacgcccgc       660
     ttcgccgacc gcctcgccat cgccgacgcc gccatcgccg ggacctcccc gctggcccgg       720
     ccgtcgcggg tggtcgagtg caagacctgc ccgtggtggc cggtgtgctc ggacgcgctg       780
     acgcaggccc gcgacgtgtc gctggtggtg cgcggcgagg acgcgatggc cctgcgccgg       840
     gccggcgtgc cgaccgtgga cgacctggcc gcgctggacc cggccgagcc cgccgtgccg       900
     ctggtcggga tggcgcacga ggacgcggtg gtgctggcgc gggcgtggct gcgcgggctg       960
     gccgtggcgc ggcgggtgcc gcggatcgag gtcgccaggg ccgaggtcga ggtcgacgtc      1020
     gacatggaga gcttcggcga cctcggcgcg tacatgtggg gctgcctgct cagcggcgcc      1080
     gacgtggggg tggagcccgg ctaccgggcg ttcgcgacct gggacaagct gccgtgcgcc      1140
     gacgaggccc gctcgttcgc cgagttctgg gcctggctga ccggggtgcg ccgcgcggcg      1200
     gccgagcgcg ggctgggctt caaggcctac tgctacaacg agttggcgga gaaccggtgg      1260
     ctgctgtcgt cggcccagcg gttcaagggt cagccgggcg tgccgccggt ggccgaggtg      1320
     aaggagttca tcacctcgga cgactgggtc gacctgttcg gcgtggtcag ggaccagttc      1380
     ctgtccacca acggcaaggg gctcaagacg atcgccccgc tggccgggtt ccactggcgc      1440
     gaccccgagg ccgggggcga gaactccatg cgctggtacc gggacgcggt cggcatggac      1500
     ggccaggagc cggacccggc gcagcggcgc aggctgctgg agtacaacga ggacgacgtc      1560
     cgggccaccc acgccctgcg gggctggatg acctcggacg ccgtggccgg gctgccgtac      1620
     gccggggacc tgtag                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page