(data stored in ACNUC7421 zone)

EMBL: CP001630.PE460

CP001630.PE460       Location/Qualifiers
FT   CDS_pept        507755..508237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0467"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; KEGG:
FT                   sfu:Sfum_0070 molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34434"
FT                   /db_xref="GOA:C6WHY3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY3"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACU34434.1"
FT                   /translation="MSAPRAARVVTASNRASAGVYADRGGPLIVGWLRERGYDVPDPAV
FT                   VPDGEPVAEALRAAVADGVAVVITTGGTGISPTDRTPEATRSVLDFEVPGLADAIRTSG
FT                   WPAVPGSVLSRGVAGVAGRTLVVNLPGSTGGVKDGLAVLDAVLEHAVEQVGGGDHR"
     gtgagcgcgc cgagggcggc ccgcgtggtg acggcgtcca accgggcctc ggccggggtg        60
     tacgccgacc ggggcgggcc gctgatcgtc gggtggctgc gcgagcgcgg ctacgacgtg       120
     ccggacccgg cggtcgtgcc ggacggcgag ccggtggccg aggcgctgcg cgcggcggtc       180
     gccgacgggg tcgcggtggt gatcaccacc ggcggcaccg gcatcagccc caccgaccgc       240
     acgcccgagg cgacccggtc ggtgctggac ttcgaggtcc ccggactggc cgacgccatc       300
     cggacgtcgg gctggcccgc cgtgcccggt tcggtgctct cgcgcggcgt cgccggggtc       360
     gccggacgca cactggtggt gaacctgccg ggatccaccg gcggggtgaa ggacggtttg       420
     gctgtgctcg acgccgtgct ggagcacgcg gtcgagcagg ttggtggagg tgatcaccgg       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page