(data stored in ACNUC7421 zone)

EMBL: CP001630.PE461

CP001630.PE461       Location/Qualifiers
FT   CDS_pept        508234..508659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0468"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   scl:sce2941 molybdopterin-converting factor chain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34435"
FT                   /db_xref="GOA:C6WHY4"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY4"
FT                   /inference="protein motif:PFAM:PF02391"
FT                   /protein_id="ACU34435.1"
FT                   /translation="MTEVLRAAVTEDPISVDEHAKLVEHASAGAVVTFSGVVRDHDHGR
FT                   SVRELEYHGHPSAGDVVAEVVSDVAGRFEGVRAVAVSHRVGPLAIGDVALAVAVSAAHR
FT                   GAAFAVCSELVDEVKRRLPVWKRQVFADGSDEWVNCP"
     gtgaccgagg tgctgcgggc ggccgtgacc gaggacccga tctcggtcga cgagcacgcg        60
     aagctcgtgg agcacgcgtc ggcgggggcg gtggtgacgt tctcgggcgt cgtgcgcgac       120
     cacgaccacg ggcggtcggt gcgggagctg gagtaccacg ggcacccgag cgcgggcgac       180
     gtcgtggccg aggtggtgtc ggacgtggcg gggcgcttcg agggcgtccg cgcggtcgcg       240
     gtgtcgcacc gcgtgggacc gctggcgatc ggcgacgtgg cgctggcggt ggccgtctcg       300
     gcggcgcacc ggggcgcggc gttcgcggtg tgctcggagc tcgtcgacga ggtgaagcgc       360
     aggctcccgg tgtggaagcg gcaggtcttc gccgacggca gcgacgagtg ggtcaactgc       420
     ccctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page