(data stored in ACNUC7421 zone)

EMBL: CP001630.PE462

CP001630.PE462       Location/Qualifiers
FT   CDS_pept        complement(509101..509775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0469"
FT                   /product="Transglycosylase domain protein"
FT                   /note="PFAM: Transglycosylase domain protein; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: vei:Veis_4083
FT                   peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34436"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY5"
FT                   /inference="protein motif:PFAM:PF06737"
FT                   /protein_id="ACU34436.1"
FT                   /translation="MAVYRGKHRFQSLRANAAVRGIAKVAVAGVIVGAPLAMAGTASAQ
FT                   GSGVNWDAVAACESGGNWSINTGNGYYGGLQFSPSTWSSHGGSGMANQASRAEQIRVAE
FT                   NVMKTQGIGAWPVCGPKGLGGGAAPARTAPAPQQAAPAPQKQSTPQKRATAPVQQQAAP
FT                   VVVALPQSNPNGDYEIKAGDTLSKIASELKVEGGWAKLHELNKQYIPNADLIMSGMKIA
FT                   TK"
     atggcggttt accgaggcaa gcaccgtttc cagtccctcc gcgccaacgc ggccgttcgc        60
     ggcatcgcga aggtggcggt ggcgggcgtc atcgtcggcg ccccgctggc catggcgggc       120
     acggcgtccg cccagggctc cggcgtgaac tgggacgccg tcgcggcgtg cgagagcggc       180
     ggcaactgga gcatcaacac cggcaacggg tactacggcg gcctgcagtt cagcccgtcg       240
     acctggagca gccacggcgg ttccgggatg gccaaccagg catccagggc cgagcagatc       300
     cgcgtggccg agaacgtcat gaagacccag ggcatcggcg cctggcccgt ctgcggcccc       360
     aagggcctcg gcggcggcgc ggccccggca cgcaccgcgc cagcgcccca gcaggcggcg       420
     cccgcgcccc agaagcagtc gacgccgcag aagcgcgcga cggccccggt ccagcagcag       480
     gcggcccccg tggtcgtggc gctgccccag agcaacccga acggcgacta cgagatcaag       540
     gcgggggaca ccctgtcgaa gatcgcctcg gagctgaagg tcgagggcgg gtgggccaag       600
     ctgcacgagc tgaacaagca gtacatcccg aacgccgacc tgatcatgtc cggcatgaag       660
     atcgccacca agtga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page