(data stored in ACNUC7421 zone)

EMBL: CP001630.PE463

CP001630.PE463       Location/Qualifiers
FT   CDS_pept        complement(510138..510401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0470"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: ade:Adeh_1120
FT                   molybdopterin synthase subunit MoaE / molybdopterin
FT                   synthase subunit MoaD"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34437"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY6"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ACU34437.1"
FT                   /translation="MVELTVRYFAGARAAAGVPAETVAVPGAGSGTTVAHVLDVVRAKH
FT                   GANLTRVLAASSFLLDGIAVRDHAAAVSAGAELDVLPPFAGG"
     gtggtcgagc tgaccgtccg ctacttcgcg ggggcccgcg ccgccgccgg ggtgcccgcc        60
     gagaccgtgg cggtgccggg cgcggggtcc gggacgaccg tggcgcacgt gctcgacgtg       120
     gtgcgcgcga agcacggggc gaacctcacc cgcgtgctgg cggcgtcgag cttcctgctg       180
     gacgggatcg cggtccggga ccacgccgcc gcggtgtccg cgggggccga gctggacgtg       240
     ctgcccccct tcgcgggcgg ttga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page