(data stored in ACNUC7421 zone)

EMBL: CP001630.PE464

CP001630.PE464       Location/Qualifiers
FT   CDS_pept        complement(510403..511428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0471"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: sus:Acid_6425 GTP cyclohydrolase subunit MoaA;
FT                   TIGRFAM: molybdenum cofactor biosynthesis protein A; PFAM:
FT                   molybdenum cofactor synthesis domain protein; Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34438"
FT                   /db_xref="GOA:C6WHY7"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY7"
FT                   /inference="protein motif:TFAM:TIGR02666"
FT                   /protein_id="ACU34438.1"
FT                   /translation="MRSAPHVTARPESPSLIDRFGRVATDLRVSLTDKCNLRCTYCMPA
FT                   EGLDWLRGPELLSDEELVRVIGIAVTRLGVTDVRFTGGEPLLRRGLEDVLAATTALEPR
FT                   PRTSMTTNGISLATRAAGLKAAGLDRVNVSLDTLDRERFRELTRRDRLPDVLAGLAAAR
FT                   EAGLEPVKINSVLMRGVNDDEAVALVEFAVEHGYQLRFIEQMPLDPQHGWDRSEMVTAQ
FT                   EILDALGTRFALAPVLARGAAPAERWVVDGGPSVVGVIAAVTRPFCAACDRTRLTADGQ
FT                   VRNCLFSGAETDLRALLRSGASDEEVAERWRGNAWAKAEGHGIDGDGFAQPDRPMSAIG
FT                   G"
     gtgcgcagtg ccccccacgt caccgcacgt ccggagtccc cctcgctcat cgaccggttc        60
     ggtcgggtgg cgaccgacct cagggtctcg ctcaccgaca agtgcaacct gcgctgcacc       120
     tactgcatgc cggccgaggg cctggactgg ttgcgggggc ccgagctgct ctccgacgag       180
     gagctggtca gggtcatcgg catcgcggtg acccggctcg gcgtgaccga cgtgcggttc       240
     accggcggcg agccgctgct gcgcaggggc ctggaggatg tgctcgcggc gaccacggcc       300
     ctggaaccga gaccgcgcac gtccatgacg accaacggca tctcgctggc gacgcgcgcg       360
     gccgggttga aggccgccgg gctggaccgg gtgaacgtgt cgctggacac cctggaccgc       420
     gagcggttcc gggagctgac caggcgggac cggctgcccg acgtgctggc ggggctcgcc       480
     gcggcgcgcg aggccggact ggaacccgtg aagatcaact cggtgctgat gcgcggggtg       540
     aacgacgacg aggccgtggc cctggtggag ttcgccgtcg agcacggcta ccagctgcgg       600
     ttcatcgagc agatgccgct cgacccgcag cacggctggg accggtcgga gatggtcacc       660
     gcccaggaga tcctggacgc gctggggacc cggttcgcac tggccccggt gctcgcgcgc       720
     ggcgccgcgc ccgccgagcg gtgggtggtc gacggcgggc cgtcggtggt gggcgtgatc       780
     gcggcggtga cccggccgtt ctgcgcggcc tgcgaccgga cccggctgac cgccgacggg       840
     caggtgcgca actgcctgtt cagcggggcg gagaccgacc tgcgggcgct gctgcgctcc       900
     ggggcctcgg acgaggaggt cgccgagcgg tggcggggca acgcctgggc caaggccgag       960
     gggcacggga tcgacgggga cgggttcgcg cagccggacc gccccatgag cgctatcgga      1020
     ggatga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page