(data stored in ACNUC7421 zone)

EMBL: CP001630.PE465

CP001630.PE465       Location/Qualifiers
FT   CDS_pept        511563..512024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0472"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bja:bll4976 transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34439"
FT                   /db_xref="GOA:C6WHY8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY8"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU34439.1"
FT                   /translation="MSEHDVPAEELERFSAHARETGALTALLHGRAAERMGLSTTDEKC
FT                   LGLALAGDVPVTAGRMAELSGLSTGAVTGVIDRLERAGYVRRVRDPHDRRKVLVEVSGP
FT                   RAGEVAVLFREAAEVLEAALRRFTPEERAVVERYQLALLEAVRGRVADA"
     atgagcgagc acgacgtccc cgccgaggaa ctggagcggt tcagcgcgca cgcgcgggag        60
     acgggcgcgc tcaccgcgct gctgcacggc agggcggcgg agcggatggg gctgtccacg       120
     acggacgaga agtgcctcgg cctcgcgctg gcgggcgacg tcccggtcac ggccgggcgg       180
     atggcggagc tctccggcct gtccaccggc gcggtgaccg gcgtcatcga ccgcctggag       240
     cgcgcgggct acgtgcgccg cgtccgcgac ccgcacgacc ggcgcaaggt gctcgtcgag       300
     gtgtccgggc ccagggcggg tgaggtggcc gtgctgttcc gggaggccgc cgaggtgctg       360
     gaggcagcgc tgcgccggtt caccccggag gagcgcgcgg tggtcgagcg ctaccagctc       420
     gccctcctgg aggcggtccg cggacgcgtg gccgacgcct ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page