(data stored in ACNUC7421 zone)

EMBL: CP001630.PE466

CP001630.PE466       Location/Qualifiers
FT   CDS_pept        512044..512832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0473"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   csa:Csal_0794 HAD-superfamily hydrolase, subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34440"
FT                   /db_xref="GOA:C6WHY9"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY9"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ACU34440.1"
FT                   /translation="MGWNYLMDMDGVLVHEEHPIPGSGEFVAELTAAGIPFLVLTNNSI
FT                   YTPRDLRARLSRTGLEVPETAIWTSALATARFLDSQRPGGSAFVIGEAGLTTALHEVGY
FT                   VLTDRDPDYVVLGETRTYSFTAITKAIRLVEEGAKFIATNPDATGPSREGSLPATGAVA
FT                   ALIERATGREPYYVGKPNSLMMRSALRALGAHSENTLMIGDRMDTDVRAGLEAGLRTIL
FT                   VLSGISADSTAELYPYRPTRVLNSIADLVGHSADPFGELG"
     atgggctgga actacttgat ggacatggac ggcgtgctgg tgcacgagga gcacccgatc        60
     cccggttccg gcgagttcgt cgccgagctg accgcggccg ggatcccctt cctcgtgctg       120
     acgaacaact ccatctacac gccgagggac ctgcgcgccc ggctgtcgag gaccggtctg       180
     gaggtcccgg agacggcgat ctggacgtcc gcgctggcca ccgcccggtt cctggactcg       240
     cagcgccccg gcggctcggc cttcgtcatc ggcgaggccg ggctgaccac ggcgctgcac       300
     gaggtcggct acgtgctgac cgaccgcgac cccgactacg tggtgctcgg cgagacccgc       360
     acctacagct tcaccgccat caccaaggcg atccggctgg tcgaggaggg ggcgaagttc       420
     atcgccacca acccggacgc caccggcccc tcgcgcgagg gctcgctgcc cgcgacgggc       480
     gcggtcgcgg cgctgatcga gcgggccacc gggcgcgagc cgtactacgt gggcaagccg       540
     aactcgctga tgatgcggtc cgcgctgcgg gcgctgggcg cgcactcgga gaacacgctc       600
     atgatcggcg accggatgga caccgacgtg cgcgccgggc tggaggcggg gctgcggacg       660
     atcctggtgc tcagcggcat ctcggcggac tcgacggccg agctgtaccc gtaccggccg       720
     acgcgggtgc tcaactccat cgcggacctg gtggggcact cggcggaccc gttcggcgag       780
     ctgggctga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page