(data stored in ACNUC7421 zone)

EMBL: CP001630.PE467

CP001630.PE467       Location/Qualifiers
FT   CDS_pept        512991..513695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0474"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503; KEGG:
FT                   scl:sce8705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34441"
FT                   /db_xref="GOA:C6WHZ0"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ0"
FT                   /inference="protein motif:PFAM:PF07398"
FT                   /protein_id="ACU34441.1"
FT                   /translation="MAERGDGLEAVVRGRFDAPVPACPGWLVGDLVRHVAEVELWWAAA
FT                   LPAGGAAPDVDGVRREVGELFAGAGPDGPRAVSARVEDGAPVWAWWSPTGRTPAAEVLR
FT                   RVAHELVVHHHDARAAVGEPLAAPPEPAEDGVAEFTERLLGGDLARPGVVGLRAVDTGR
FT                   TRSVGSAGDGLRLLTADEADRVRAGGGAEGALSGTAELLHLALWRRAPLERLEVGGSTG
FT                   LARAALAASRLG"
     gtggcggagc gcggcgacgg tctggaggcg gtggtgcgcg ggcggttcga cgcgcccgtg        60
     cccgcctgtc ccggttggct ggtgggcgac ctggtccggc acgtcgccga ggtcgagctg       120
     tggtgggcgg cggcgctgcc cgccggtggc gccgcgcccg acgtggacgg ggtgcgccgc       180
     gaggtcggcg agctgttcgc cggtgcgggg ccggacggcc cgcgggcggt gtccgcgcgg       240
     gtcgaggacg gcgcgccggt gtgggcctgg tggtcgccga ccgggcggac cccggcggcc       300
     gaggtgctgc gcagggtggc gcacgagctg gtggtgcacc accacgacgc ccgcgcggcg       360
     gtcggcgaac cgctggcggc gccgcccgag ccggccgagg acggggtggc cgagttcacc       420
     gagcgcctcc tcggcggcga cctcgcgcga ccgggcgtgg tggggctgcg ggccgtcgac       480
     accggccgga cccggtcggt cgggtcggcg ggggacgggc tccggctgct caccgcggac       540
     gaggccgacc gggtccgcgc gggcggaggg gcggagggcg cgctgtccgg gacggcggag       600
     ctgctgcacc tggcgctgtg gcggcgcgcg cccctggagc ggctggaggt cggggggagc       660
     accgggctgg cgcgcgccgc gctcgccgcg tcccgcttgg gctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page