(data stored in ACNUC7421 zone)

EMBL: CP001630.PE468

CP001630.PE468       Location/Qualifiers
FT   CDS_pept        514093..514917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0475"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: serine/threonine
FT                   protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34442"
FT                   /db_xref="GOA:C6WHZ1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ1"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACU34442.1"
FT                   /translation="MPAPPRAVAYRRCVERQLYVVGDVHGHLAELTRALNAAGLVDDSG
FT                   DWSGGDAELWFLGDFVDRGPDGIGVIDLVMRLSAQAGESGGRVDSLVGNHEVLLLGMHR
FT                   FGDEDVPGAPTPRSFAKSWNLNGGLRSDQDRLTPEHVEWLTSRDVVHLVDGHLLMHSDT
FT                   LAYLEWGGTVDEVNEAVRAILTGDDLAQWWECWRKMTTRYAFRGPEGGVVAGELLKLMG
FT                   GAEIVHGHSVFADQLGVMPEEVDGPLRYADDRVLAVDAGLYSGGPCLVVELR"
     ttgcccgcgc cgccccgcgc cgtcgcatat cgtcgctgtg tggaacgcca gctttacgtg        60
     gtcggcgacg tgcacggcca cctcgccgaa ctcactcgcg cgctcaacgc ggcaggcctc       120
     gtggacgact ccggggactg gagcggcggt gacgcggagc tgtggttcct cggcgacttc       180
     gtcgaccgcg gtcccgacgg gatcggcgtc atcgacctcg tcatgcggct ctccgcgcag       240
     gcgggcgaga gcggcgggcg ggtcgactcg ctggtcggca accacgaggt cctgctgctc       300
     gggatgcacc gcttcggcga cgaggacgtg ccgggcgcgc ccaccccgcg cagcttcgcc       360
     aagagctgga acctcaacgg cggcctgcgc agcgaccagg accggctcac ccccgagcac       420
     gtcgagtggc tgaccagccg cgacgtcgtg cacctggtgg acggccacct gctcatgcac       480
     tccgacacgc tcgcctacct ggagtggggc ggcaccgtgg acgaggtcaa cgaggcggtg       540
     cgcgcgatcc tcaccggcga cgacctggcg cagtggtggg agtgctggcg caagatgacc       600
     acccgctacg cgttccgcgg ccccgagggc ggggtcgtcg cgggggagct gctcaagctc       660
     atgggcggcg ccgagatcgt gcacgggcac agcgtcttcg ccgaccagct cggcgtcatg       720
     cccgaggagg tcgacggccc gctgcggtac gcggacgacc gggtcctcgc ggtcgacgcg       780
     ggcctgtaca gcggcgggcc gtgcctggtg gtcgagctgc gctga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page