(data stored in ACNUC7421 zone)

EMBL: CP001630.PE469

CP001630.PE469       Location/Qualifiers
FT   CDS_pept        complement(514951..515325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0476"
FT                   /product="protein of unknown function DUF307"
FT                   /note="PFAM: protein of unknown function DUF307; KEGG:
FT                   rpa:RPA0774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34443"
FT                   /db_xref="GOA:C6WHZ2"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ2"
FT                   /inference="protein motif:PFAM:PF03733"
FT                   /protein_id="ACU34443.1"
FT                   /translation="MRLVLNLIWLVISGFWLAVGYAIAGVICCVFIITIPWGLASFRIA
FT                   NYALWPFGRDVVDRHDAGAASLLGNIIWIVVAGWWLAIGHIVTGLALCVTIIGIPMGIA
FT                   NFKLIPVSLMPLGKVIVDRP"
     atgcgcctcg tgctcaacct catctggctg gtgatcagcg gcttctggct cgcggtcggt        60
     tacgcgatcg cgggggtgat ctgctgcgtc ttcatcatca cgatcccctg ggggctcgcc       120
     tcgttccgca tcgcgaacta cgcgctgtgg ccgttcggcc gggacgtggt cgaccggcac       180
     gacgccgggg ccgcctcgct cctgggcaac atcatctgga tcgtcgtcgc cgggtggtgg       240
     ctggcgatcg ggcacatcgt gaccggcctc gccctgtgcg tcacgatcat cggcatcccg       300
     atgggcatcg cgaacttcaa gctcatcccg gtgtcgctga tgccgctggg caaggtcatc       360
     gtcgaccgcc cctga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page