(data stored in ACNUC7421 zone)

EMBL: CP001630.PE47

CP001630.PE47        Location/Qualifiers
FT   CDS_pept        complement(51262..52014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0047"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bac:BamMC406_2467 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34021"
FT                   /db_xref="GOA:C6WCK0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCK0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34021.1"
FT                   /translation="MEISGTAAIVTGGASGLGAATARALAARGARVFALDISVDGAPAV
FT                   EGVTYLAADVTSEEDVQAAVDTAAGSGAPLRIAVNCAGIGPSTRTVGKAGPHPLDLYRK
FT                   VLDVNVVGTFNVLRLAAAAMGATEPGPDGARGVVVNTASVAAYEGQIGQVAYASSKAAV
FT                   VGMTLPAARDLSSVGVRVMTIAPGIVDTPMLATVSEEFRAGLAAGVPFPKRLALPDEYA
FT                   RLALSIIEHDYLNGEVVRMDGALRMAPR"
     atggagatct cgggcaccgc ggcgatcgtc accggcggag cgtcggggct gggcgccgcc        60
     accgcgcgcg cgctcgccgc gcggggggcg cgcgtgttcg cgctggacat ctcggtggac       120
     ggcgcccccg ccgtggaggg cgtcacctac ctggcggcgg acgtcacctc ggaggaggac       180
     gtccaagcgg ccgtcgacac cgccgcgggc tccggcgctc cgctgcggat cgcggtgaac       240
     tgcgcgggca tcggcccgtc gaccaggacg gtcggcaagg ccggtccgca cccgctcgac       300
     ctgtaccgca aggtcctgga cgtgaacgtg gtcggcacgt tcaacgtcct gcgcctggcc       360
     gccgccgcga tgggcgcgac cgagccgggg ccggacggcg cgcgcggcgt cgtggtcaac       420
     accgcctccg tcgccgccta cgagggccag atcggccagg tcgcctacgc gtcctcgaag       480
     gccgcggtgg tcggcatgac gctgcccgcc gcgcgcgacc tgtcctcggt cggcgtccgg       540
     gtcatgacca tcgcgcccgg catcgtcgac accccgatgc tggcgaccgt gtccgaggag       600
     ttccgcgcgg gcctggccgc cggggtgccg ttccccaagc ggctggccct gccggacgag       660
     tacgcgaggc tggcgctgtc gatcatcgag cacgactacc tgaacggcga ggtcgtccgg       720
     atggacggcg cgctgcgcat ggcgcccagg tag                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page