(data stored in ACNUC7421 zone)

EMBL: CP001630.PE470

CP001630.PE470       Location/Qualifiers
FT   CDS_pept        515358..516356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0477"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; homoserine
FT                   dehydrogenase NAD-binding; Oxidoreductase domain; KEGG:
FT                   similar to dimeric dihydrodiol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34444"
FT                   /db_xref="GOA:C6WHZ3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ3"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACU34444.1"
FT                   /translation="MLRTVRWGIVATGGIADVVTADLLALEGSEALAVSSRKLERAREF
FT                   ATKHGIPRAYGSVEELVADPDVDVVYVATPHAQHRSAARLALEAGKHVLCEKPMTLTVE
FT                   DTRELVELARERGLFLMEAIWTRFNPLIRQVRAAVADGEIGDVRSVRADFGFALPFEPG
FT                   HRLWNPELGGGSLMDLGLYPVSIAQMLLGDPTTIQVTGSLAPSGVDAEAALLLGYESGA
FT                   HALLTSTLTTSPGSYATVFGTEGRIDLHQPAHCPTRVVINDVERTAELEGSGYVPQLRE
FT                   VADRVRAGDTESPDMSWADSLSIARVLAEGVARLGVRYPQPDRDVTPPTAG"
     gtgctgagaa cagttcgctg gggaatcgtc gccacgggtg gcatcgccga tgtcgtcacc        60
     gccgacctgc tcgccctgga gggctccgaa gccctcgcgg tctcctcccg caagctcgaa       120
     cgggcacggg agttcgccac caagcacggc atcccgcgtg cgtacggcag cgtggaggag       180
     ctggtcgccg accccgacgt ggacgtcgtc tacgtcgcca cgccgcacgc gcagcaccgg       240
     tccgccgcgc gcctcgccct cgaggcgggc aagcacgtgc tgtgcgagaa gcccatgacg       300
     ctcaccgtcg aagacacccg cgagctggtc gagctggccc gcgagcgggg cctgttcctc       360
     atggaggcca tctggaccag gttcaacccg ctcatccgcc aggtccgcgc ggccgtcgcg       420
     gacggcgaga tcggcgacgt gcgcagcgtg cgcgccgact tcggcttcgc cctgccgttc       480
     gagcctgggc accggctgtg gaacccggag ctgggcggcg ggtccctgat ggacctcggc       540
     ctgtacccgg tctcgatcgc ccagatgctg ctcggcgacc cgacgaccat ccaggtcacc       600
     ggctccctcg ccccgtccgg ggtggacgcg gaggccgcgc tgctgctcgg ctacgagagc       660
     ggcgcgcacg cgctgctcac ctccacgctg accacctcgc ccggctcgta cgcgacggtg       720
     ttcggcaccg aggggcgcat cgacctgcac cagcccgcgc actgcccgac ccgcgtcgtg       780
     atcaacgacg tggagcgcac cgccgagctg gagggctccg ggtacgtgcc gcagctgcgc       840
     gaggtggccg accgggtgcg cgccggtgac accgagagcc cggacatgtc ctgggcggac       900
     tcgctgtcca tcgcgcgcgt gctggccgag ggcgtggcgc ggctgggcgt gcgctacccg       960
     cagccggacc gggacgtcac cccgcccacc gcgggctag                              999
//

If you have problems or comments...

PBIL Back to PBIL home page