(data stored in ACNUC7421 zone)

EMBL: CP001630.PE471

CP001630.PE471       Location/Qualifiers
FT   CDS_pept        complement(516334..517299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0478"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bbt:BBta_0237
FT                   OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34445"
FT                   /db_xref="GOA:C6WHZ4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR040611"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34445.1"
FT                   /translation="MITCLYKGPALVPKLSVVTEFTGTARPEATPAAALRPPAAPPVPR
FT                   RAPCGEPTVPLARADARPLAPDTGPRPPESPAAHAHQPESHAAHPHQGLAAPPDAAAPP
FT                   DAAAPRPARREPATAPIPAAPTEPPGPIIDAAVALVAEHGARGLRVADVASRAGVSRQT
FT                   VYNEHGNKQRLVEAVALVKTTEFVDAARACLARAPGAVEGVAEAVRQVHALTRLDPLAR
FT                   SVLTGTDADDMLPMLTTRGGWVLDLVVPAIGEHLARHRPDLPPARVAFAADVLTRLALS
FT                   HLLTPDHGADGEVDRAVDLAVEAVTGVAVALLGPSPRWAG"
     gtgatcacgt gtctttacaa ggggcccgcg ctcgtgccaa aactgtccgt cgtgaccgag        60
     ttcaccggga ccgcgcgccc cgaggccaca ccggcggcgg cactccgacc gcccgcggcg       120
     cccccggtcc cccgccgagc cccgtgcggc gagccgaccg tccccttagc ccgcgccgac       180
     gcccgcccgc tcgcccccga caccgggccg cgcccgcccg aaagccctgc cgcgcacgcg       240
     caccagcccg agagccacgc cgcgcacccg caccagggtc tcgccgctcc cccggacgca       300
     gccgcacccc cggacgcggc cgcaccccgc cccgcccgcc gggaacccgc caccgccccc       360
     atccccgccg ccccgaccga accccccggc ccgatcatcg acgccgccgt cgcactcgtc       420
     gccgagcacg gcgcgcgcgg gctgcgggtc gccgacgtcg cctcgcgcgc cggggtgagc       480
     aggcagaccg tctacaacga gcacggcaac aagcagcggc tggtcgaggc cgtcgcgctg       540
     gtcaagacca ccgagttcgt ggacgccgcc cgcgcctgcc tggcccgcgc gccgggcgcg       600
     gtggaggggg tcgcggaggc ggtgcggcag gtgcacgcgc tcacccggct cgacccgctg       660
     gcccgctcgg tcctcaccgg caccgacgcc gacgacatgc tgccgatgct caccacgcgc       720
     ggcggttggg tgctggacct ggtggtgccc gccatcggcg agcacctggc caggcaccgg       780
     ccggacctgc cgcccgcgcg cgtcgcgttc gcggcggacg tgctgacccg gctggcgctc       840
     agccacctgc tgacccccga ccacggcgcc gacggcgagg tcgaccgggc ggtcgacctc       900
     gccgtcgagg ccgtgacggg ggtcgcggtg gcgctgctcg gtcctagccc gcggtgggcg       960
     gggtga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page