(data stored in ACNUC7421 zone)

EMBL: CP001630.PE472

CP001630.PE472       Location/Qualifiers
FT   CDS_pept        517475..518131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0479"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: afw:Anae109_2037 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34446"
FT                   /db_xref="GOA:C6WHZ5"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ5"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ACU34446.1"
FT                   /translation="MPLTIGFDLDMTLIDPRPGMAAVMEAVRAESGYPIDGAHFAANLG
FT                   PPLDVSFRGYGVPEEDVPVLVARFRALYPEIVIPATVALPGAAESLDAVRELGGTTVVV
FT                   TGKYRANAALHLAAFDWEVDHLFGELWSTGKAEALKLHGASAYVGDHVGDVRGAKAAGA
FT                   LSVCVVTGPCDERELVEAGADVVMPDLTGFPAWLRENADRLRATGRAALEAERPA"
     gtgccgctga ccatcggttt cgacctggac atgaccctca tcgaccccag gccgggcatg        60
     gccgccgtga tggaggcggt tcgcgccgag agcggctacc cgatcgacgg cgcgcacttc       120
     gccgccaacc tcggcccgcc cctcgacgtc tcgttccggg ggtacggcgt gcccgaggag       180
     gacgtcccgg tcctggtcgc ccgcttccgc gcgctctacc cggagatcgt catcccggcg       240
     accgtcgcgc tgcccggcgc ggccgagtcg ctcgacgccg tgcgcgagct gggcgggacc       300
     accgtcgtcg tcaccggcaa gtaccgggcg aacgcggcgc tgcacctggc cgcgttcgac       360
     tgggaggtcg accacctgtt cggcgagctc tggtccaccg gcaaggccga ggcgctcaag       420
     ctgcacgggg cctcggcgta cgtcggcgac cacgtgggcg acgtgcgcgg cgcgaaggcc       480
     gcaggcgcgc tgtccgtgtg cgtggtcacc gggccgtgcg acgagcggga gctggtcgag       540
     gcgggcgcgg acgtggtcat gcccgacctg accggcttcc cggcgtggct gcgcgagaac       600
     gccgaccggc tccgcgcgac cgggcgcgcc gccctggaag ccgagcgccc cgcctag          657
//

If you have problems or comments...

PBIL Back to PBIL home page