(data stored in ACNUC7421 zone)

EMBL: CP001630.PE474

CP001630.PE474       Location/Qualifiers
FT   CDS_pept        518534..518929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0481"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: bcy:Bcer98_3497 cold-shock DNA-binding
FT                   domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34448"
FT                   /db_xref="GOA:C6WHZ7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ7"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACU34448.1"
FT                   /translation="MRAVPTGKVKWYDSEKGFGFVTQDGGEDVYVRKSALPEGVDALKA
FT                   GQRIEFGMAEGRRGPQALSVRLVDPAPSVAEARRRPADELNVVIEDLIRLLEQRVQPEL
FT                   RRSRYPERKSAKLVADALRAIARDLDP"
     gtgagagcgg tgccgaccgg caaggtcaag tggtacgact cggagaaggg cttcggcttc        60
     gtcacgcagg acggcggcga ggacgtctac gtgcggaagt ccgcgctgcc cgaaggggtc       120
     gacgccctca aagccggtca gcgcatcgag ttcggcatgg ccgaggggcg ccgggggccg       180
     caggccctgt ccgtgcgcct ggtcgacccg gcgccgtcgg tggccgaggc gcgcaggcgc       240
     cccgccgacg agctgaacgt ggtgatcgag gacctgatca ggctgctgga gcagcgggtc       300
     cagcccgagc tgcgccgcag ccgctacccc gagcgcaaga gcgccaagct cgtcgccgac       360
     gcgctgcgcg ccatcgcgcg ggacctcgac ccgtag                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page