(data stored in ACNUC7421 zone)

EMBL: CP001630.PE475

CP001630.PE475       Location/Qualifiers
FT   CDS_pept        complement(519009..519494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34449"
FT                   /db_xref="InterPro:IPR024495"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34449.1"
FT                   /translation="MRRAVVLTALPLLLATGCGAPPHPEVTFYADGRTVVVAPTQYCDL
FT                   DSENCDVDPSAAGVLRVRPGKPVQISVPAQLADSVWAVAFTYRDAAGVTQEPMRSKVFT
FT                   PNNPQHAYTLQLPNDTDQLESVEVQQLGTRIEGSTTAAVDFVARGTWVLSVDDRQRG"
     gtgcgccgag ccgtcgtcct caccgcgttg ccgctgctcc tggccaccgg ctgcggtgcg        60
     cccccgcacc ccgaggtgac cttctacgcc gacggcagga ccgtcgtggt cgcgccgacc       120
     cagtactgcg acctcgactc ggagaactgc gacgtggacc cgtcggcggc gggcgtgctg       180
     cgggtgcggc cgggcaagcc ggtgcagatc tcggtgcccg cgcagctcgc cgacagcgtg       240
     tgggcggtgg cgttcaccta ccgcgacgcg gccggggtga cccaggagcc gatgcgcagc       300
     aaggtgttca cgccgaacaa cccgcagcac gcgtacacgc tccagctgcc gaacgacacc       360
     gaccagctgg agagcgtcga ggtgcagcag ctgggcaccc gcatcgaggg cagcacgacc       420
     gccgccgtgg acttcgtggc gcgcggcacg tgggtgctgt ccgtggacga ccggcagcgg       480
     ggctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page