(data stored in ACNUC7421 zone)

EMBL: CP001630.PE476

CP001630.PE476       Location/Qualifiers
FT   CDS_pept        complement(519518..521248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0483"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mrd:Mrad2831_4876 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34450"
FT                   /db_xref="GOA:C6WHZ9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34450.1"
FT                   /translation="MSPSDDRDHPRGDHPREDETRPERGGAGRERSDSAPWETYDPDGY
FT                   DRLSRERGRGRAERDHYDREAYDERGRERGGADRDTVPTGQAGPRRTKPIPGRDERTRP
FT                   THKPTQLPRKLTVTRVALYRARLLSSVGLGRLRTAAHADGAGESGLSSLTYAVMLGLAA
FT                   DAALAVALANALFFSAGVDESRTRAGLYLLVAAVPFALLAPLLGPALDHLRRGRRWALA
FT                   GSCALRVAAAVVLALHFDGWALYPAALVSVLLSRSFTALREAITPEVLPPEVERARADA
FT                   RLTAFGLVAGVVSGLAAIGLVNTFGPPGALWLSAALCVANTWCCLRVPARAEVAEGGTP
FT                   GARGQGAAGRDAKGPDAKGPDAKGQDAKGRERGRRALGRAVVAALWANGSIRVLAGFLV
FT                   LFAAFLVRAEVEYDPVQQLLLLGVVVAAAVAGGLLGGVVGARLPAGSPDRVLIGCVGAA
FT                   LASALLAAALPGLTTVAVVGLVGAAAGTLAKATLDAVARDELPERSPALVRPEALLRLG
FT                   WVFGGALGVLLPTEQWIGFAVVSLLLALGLAQVVLTWRGRSLLPRIGGDRQAGAGAADG
FT                   "
     atgagcccgt ccgacgatcg cgatcacccg cggggggatc acccgcgaga ggacgagacc        60
     cggcccgaac gcgggggcgc gggacgggag cgctcggaca gcgcgccctg ggagacctac       120
     gaccccgacg gctacgaccg gctcagccgg gagcgcgggc gcgggcgcgc cgagcgggac       180
     cactacgacc gcgaggccta cgacgagcgc ggccgggagc ggggcggggc ggaccgggac       240
     accgtcccga ccgggcaggc gggcccccgg cgcaccaagc cgatccccgg ccgcgacgag       300
     cgcaccaggc ccacccacaa gccgacccag ctgcccagga agctgaccgt cacccgcgtc       360
     gcgctgtacc gggcgaggct gctgtcctcg gtgggcctcg gccggttgcg caccgccgcg       420
     cacgccgacg gcgccgggga gtccggcctg tcctcgctca cctacgcggt gatgctgggc       480
     ctggccgccg acgcggcgct ggccgtggcg ctggcgaacg cgctgttctt ctccgccggg       540
     gtggacgagt ccaggacccg cgcggggctc tacctgctgg tcgccgcggt cccgttcgcg       600
     ctgctcgccc cgcttctcgg cccggcgctg gaccacctgc ggcgcggaag gcggtgggcg       660
     ctggccgggt cgtgcgcgct gcgcgtggcg gcggcggtgg tgctggcgct gcacttcgac       720
     ggctgggcgc tgtacccggc cgcgctggtg agcgtgctgc tgtcccggtc gttcaccgcg       780
     ctgcgggagg cgatcacccc ggaggtgctg ccgccggagg tcgagcgggc cagggccgat       840
     gcccggctga cggcgttcgg gctggtcgcg ggcgtggtgt ccgggctggc ggcgatcggg       900
     ctggtgaaca cgttcggccc gccgggcgcg ctgtggctca gcgccgcgct gtgcgtggcg       960
     aacacctggt gctgcctgcg ggtaccggcg cgcgcggagg tcgccgaggg cgggactccg      1020
     ggcgcgaggg ggcagggcgc ggcgggccgg gacgcgaagg gcccggatgc gaagggcccg      1080
     gatgcgaagg ggcaggacgc gaagggccgg gagcgcgggc ggcgggcgct cggtcgcgcg      1140
     gtcgtggcgg cgctgtgggc gaacgggtcg atccgggtgc tcgcgggctt cctggtcctg      1200
     ttcgccgcgt tcctggtgcg ggcggaggtc gagtacgacc cggtccagca gttgctgctg      1260
     ctcggcgtgg tcgtggcggc ggcggtcgcg ggcgggctgc tgggcggcgt ggtcggcgcg      1320
     cggctcccgg cgggctcgcc ggaccgggtg ctgatcggct gcgtcggcgc ggcgctggcc      1380
     tcggcgctgc tggcggcggc gctgccgggg ctgacgacgg tggcggtggt cgggctggtc      1440
     ggggccgcgg cggggacgct ggcgaaggcg accctggacg cggtcgcgcg ggacgagctg      1500
     ccggagcggt cgcccgcgct cgtgcggcct gaggcgctgc tgcggctggg ctgggtgttc      1560
     ggcggggcgc tgggcgtgct gctgcccacc gagcagtgga tcgggttcgc ggtggtctcg      1620
     ctgctgctcg cgctcggcct ggcgcaggtg gtgctgacct ggcgaggccg ctcgctgctg      1680
     ccccggatcg gcggggaccg gcaggccggg gccggtgcgg cggacggctg a               1731
//

If you have problems or comments...

PBIL Back to PBIL home page