(data stored in ACNUC7421 zone)

EMBL: CP001630.PE477

CP001630.PE477       Location/Qualifiers
FT   CDS_pept        complement(521305..522084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0484"
FT                   /product="glutamine cyclotransferase"
FT                   /note="PFAM: glutamine cyclotransferase; KEGG:
FT                   sus:Acid_3566 glutamine cyclotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34451"
FT                   /db_xref="GOA:C6WI00"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI00"
FT                   /inference="protein motif:PFAM:PF05096"
FT                   /protein_id="ACU34451.1"
FT                   /translation="MVPVVVVAVLSGCSSGGDGVRSTEPAGPSTPATARPEVLGTIPHD
FT                   PAAFTQGLEVSGDALYEGTGLEGRSSIREVDPATGEVRRKLDLPSPLFGEGITVVGERI
FT                   WQLTWRDGVAIERDRASLAEVRRVPYEGEGWGLCLDGDRLVMSDGTADLTFRDPATFEE
FT                   RGRVAVTRAGEPLEDLNELECVDGRVWANVWQTDEVVRIDPVTGAVDLVADLSSLRPEG
FT                   VPASDVLNGIASVPGSDEFLVTGKNWPSMFRVRLPPG"
     gtggtcccgg tcgtggtggt ggcggtgctg tcgggctgct cgtccggtgg ggacggtgtt        60
     cggtcgaccg aacccgctgg accgtccaca ccggccacgg cgcgcccgga ggtcctggga       120
     acgatcccgc acgaccccgc cgcgttcacc cagggcctgg aggtctccgg ggacgcgctc       180
     tacgagggca ccggtctgga aggccggtcg agcatccgcg aggtcgaccc cgccaccggc       240
     gaggtccgca ggaagctgga cctgccgtcg ccgctgttcg gcgaggggat caccgtggtg       300
     ggcgagcgga tctggcagct cacctggcgc gacggcgtgg cgatcgagcg cgaccgggcg       360
     tcgctggccg aggtccgccg cgtgccgtac gagggcgagg gctggggcct gtgtctggac       420
     ggcgaccggc tggtgatgag cgacggcacc gccgacctga ccttccgcga ccccgcgacg       480
     ttcgaggagc gcgggcgggt cgcggtgacg cgcgccgggg agccgctgga ggacctgaac       540
     gagctggagt gcgtcgacgg ccgggtgtgg gcgaacgtgt ggcagaccga cgaggtggtg       600
     cggatcgacc cggtcaccgg cgcggtcgac ctcgtggcgg acctgtcgtc gctgcgcccg       660
     gagggcgtgc ccgcgtcgga cgtgctgaac gggatcgcct cggtgcccgg ctcggacgag       720
     ttcctggtca ccggcaagaa ctggccgagc atgttccggg tgcgcctccc cccgggctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page