(data stored in ACNUC7421 zone)

EMBL: CP001630.PE478

CP001630.PE478       Location/Qualifiers
FT   CDS_pept        522145..523071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GL17023 gene product from transcript GL17023-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34452"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34452.1"
FT                   /translation="MRHNPPVTATPTQQPQPVLADPAAVRLARDAAQEEAGSEHVGAHV
FT                   GVLVEDETSVTHFFEADHAGYRGWRWAVTLATAGEGSPVSVSEAVLLPGNDALVAPQWV
FT                   PWNERVRAGDLGVGDLLPASPDDPRLAPGYVGSEDPAVEEVALEVGLGRVRVLSREGVL
FT                   DAAERWRGGDFGPRSEMARSAPAACGTCGFYLRVAGALGAAFGVCGNELTPADGHVVHV
FT                   EYGCGAHSEVEVEGGSAVPVADVVYDDALLEVEVNEPVGRSDNDTADAAAGGATAGEGD
FT                   TPGAVDEVERVSDGSGATGVSGRATSR"
     gtgcggcaca atccacctgt gaccgccacg ccgactcagc agccccagcc agtgctcgcc        60
     gaccccgcgg ccgtgcggct cgcgcgcgac gcggcgcagg aggaagccgg atcggagcac       120
     gtgggggccc acgtcggcgt cctcgtcgag gacgagacgt cggtcaccca cttcttcgag       180
     gccgatcacg ccggttaccg gggctggcgg tgggccgtca cgctcgccac cgcgggcgag       240
     ggctcgccgg tctcggtcag cgaggccgtg ctgctgcccg gcaacgacgc gctggtcgcc       300
     ccgcagtggg tgccgtggaa cgagcgggtc cgcgccggtg acctcggcgt cggcgacctg       360
     ctgcccgcgt cccccgacga ccccaggctc gcgcccggct acgtcgggtc cgaggacccg       420
     gcggtcgagg aggtcgcgct ggaggtcggc ctcggccggg tgcgcgtgct ctcccgcgag       480
     ggcgtgctgg acgccgccga gcgctggcgc ggcggcgact tcgggccgcg cagcgagatg       540
     gcgcgcagcg cgcccgccgc gtgcgggacc tgcgggttct acctgcgcgt cgccggggcg       600
     ctcggggcgg cgttcggggt gtgcggcaac gagctgacgc ccgcggacgg gcacgtggtg       660
     cacgtcgagt acgggtgcgg cgcgcactcc gaggtcgagg tggagggcgg ttcggcggtg       720
     ccggtggcgg acgtcgtgta cgacgacgcg ctgctggagg tcgaggtgaa cgagcccgtg       780
     ggccggtccg acaacgacac cgccgacgcc gccgctggcg gcgccaccgc gggcgagggc       840
     gacacgcccg gcgccgtgga cgaggtcgag cgggtttccg acgggtccgg cgccaccggg       900
     gtctccggtc gggcgacatc ccggtga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page