(data stored in ACNUC7421 zone)

EMBL: CP001630.PE479

CP001630.PE479       Location/Qualifiers
FT   CDS_pept        523068..525896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_3709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34453"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34453.1"
FT                   /translation="MSADHFGTEALRESVLAAWRGSPTRFREDANAEEDLRLGGYRDRL
FT                   LVELAQNAADAAGAEPGVLRLSFVDGEFRAANTGAPLTADGVTALASLRASAKSSDAVG
FT                   QFGVGFAAVLAVTDAPRVVSTSGGVAFSAARTREAVPELASKRGGDVPVLRLVWPTDEA
FT                   GPPEGFATEVRLPLTAVDGDALLRECAEQAPDLLLALPGLRRVEVGSRAWDRAEDGDKV
FT                   VITGPDGERAWLVHRVGGELPERFVQGVESRPVWSACWAYPVDGALDGEVLHAPTPTDE
FT                   KLSLPARLIATLPVEPSRRRVLVGPAAEHVLAMAARAYPALVAALPAVERTALVPLPGF
FT                   PLSEVDGVLRQGVLAALRDAEWLPKADGGWTSPRRAKVLDSPSEDLVDLLEDVVPGLLD
FT                   AELVLPEHARALAALDVPRMPVAEVVAALAGIGGEPGWWHDVYTALQPWADVDSSAREE
FT                   LGALPVPLADGRLVSGPRGVLMLDEPIDFERTGLRVAHPEAVHPLLLRLGAVEAGAAEV
FT                   LDSDAVRDAVRHSGDDPDEDLVHGVLSLVARAGGRPWLGELVLPEAGGGWRRADELLLP
FT                   DAPLREVLADDAPFGVLDAEFAADWPRDVLSAVGAADGFTVLVDDEPTGPDHDLADEAD
FT                   WWDAADEPPSRVVGVRDLDLVAEGKWTRALELMASDPEVWRAVARRDGYAGWWLARYAR
FT                   IDGRAPRAWRLPGAVELEGLYDPVGSELPAHVLAAAGVRTELVVHDEDDVVDLLARLGD
FT                   AERVVPDALVLKAHAALAEVAPDVREGAVEPPDHVRVLTGAVVSADDVVVPDLPWLLAV
FT                   LPGEQVLAADGGAAELAELLELPLASEEVVGSLRSEGDEVVWAELGAVRVACALLGVEL
FT                   PRGTVVVHDELVVHAEGEEHEVPWWVDGEVVHAADTPEGLARALAWTTGRWADRHTFAA
FT                   LITEPTPAVLLG"
     gtgagcgcgg accacttcgg caccgaggcc ctgcgggagt cggtgctcgc cgcctggcgc        60
     ggttcgccca cccgcttccg cgaggacgcc aacgccgagg aggacctgcg gctcggcggg       120
     taccgcgacc ggctgctggt cgagctggcg cagaacgcgg ccgacgccgc gggcgccgag       180
     ccgggcgtgc tgcggctgtc cttcgtggac ggcgagttcc gcgcggccaa caccggcgcg       240
     ccgctgaccg ccgacggcgt gacggcgctc gcgtcgctgc gcgcctccgc gaagagctcc       300
     gacgcggtcg gccagttcgg cgtgggcttc gcggccgtgc tggcggtgac cgacgcgccg       360
     cgcgtggtgt ccacgtccgg cggggtcgcg ttctccgccg cgcgcacccg cgaggccgtg       420
     ccggagctgg cgtccaagcg cggcggcgac gtgcccgtgc tgcgcctggt gtggccgacc       480
     gacgaggccg gtccgcccga gggcttcgcc accgaggtcc ggctgccgct caccgccgtg       540
     gacggcgacg ccctgctgcg cgagtgcgcc gagcaggcgc ccgacctgct gctcgccctc       600
     cccggcctgc gccgggtcga ggtcgggtcg cgggcctggg accgcgccga ggacggcgac       660
     aaggtcgtga tcaccggtcc ggacggcgag cgcgcctggc tcgtgcaccg ggtcggcggc       720
     gagctgcccg agcgcttcgt gcagggcgtc gagtcccggc cggtgtggtc ggcgtgctgg       780
     gcgtacccgg tcgacggcgc gctcgacggc gaggtgctgc acgcgccgac ccccaccgac       840
     gagaagctgt ccctgcccgc gcgcctgatc gccacgctgc ccgtcgagcc gtcccgccgc       900
     cgggtgctgg tcggaccggc cgccgagcac gtgctggcca tggcggcgcg ggcgtacccg       960
     gcgctggtgg ccgcgctgcc cgccgtggag cggaccgcgc tggtgccgct gcccggcttc      1020
     ccgctgtccg aagtggacgg tgtgctgcgg cagggcgtgc tggccgcgct gcgggacgcc      1080
     gagtggctgc ccaaggcgga cggcggctgg acctcgccga ggcgggcgaa ggtgctggac      1140
     tcgccgtccg aggacctggt cgacctgctg gaggacgtgg tccccggcct gctggacgcc      1200
     gagctggtgc tgcccgagca cgcgcgggcc ctggccgcgc tggacgtgcc gaggatgccg      1260
     gtggccgagg tggtggccgc gctggcgggc atcggcggcg agccgggctg gtggcacgac      1320
     gtgtacacgg cgctccagcc gtgggccgac gtggactcgt ccgcgcgcga ggagctgggc      1380
     gcgctcccgg tgccgctcgc ggacggcagg ctggtcagcg ggccgcgcgg cgtgctgatg      1440
     ctggacgagc cgatcgactt cgagcgcacc gggctgcgcg tcgcgcaccc ggaggccgtg      1500
     cacccgctgc tgctgcgcct gggcgcggtg gaggcggggg cggccgaggt gctcgactcg      1560
     gacgcggtcc gcgacgccgt gcggcacagc ggcgacgacc cggacgagga cctggtgcac      1620
     ggggtcctgt ccctggtggc gcgcgcgggc gggcggccgt ggctgggcga gctggtcctg      1680
     ccggaggcag gcgggggctg gcggcgcgcg gacgagctgc tgctgccgga cgcgccgctg      1740
     cgcgaggtgc tggccgacga cgcgccgttc ggcgtgctgg acgcggagtt cgcggcggac      1800
     tggccgcgcg acgtgctgtc ggcggtgggc gcggcggacg gcttcacggt gctggtcgac      1860
     gacgagccga ccgggcccga ccacgacctg gccgacgagg cggactggtg ggacgccgcc      1920
     gacgagccgc cctcgcgggt ggtgggcgtg cgcgacctgg acctggtggc cgaggggaag      1980
     tggaccaggg cgctggagct gatggcgtcc gaccccgagg tgtggcgcgc ggtcgcgcgg      2040
     cgcgacgggt acgcggggtg gtggctggcg cggtacgcgc ggatcgacgg ccgggcgccc      2100
     cgcgcgtggc ggctgccggg ggcggtggag ctggaggggc tgtacgaccc ggtgggctcc      2160
     gagctgcccg cgcacgtcct ggcggctgcc ggggtgcgga ccgagctggt ggtgcacgac      2220
     gaggacgacg tggtcgacct gctggcgcgg ttgggcgacg cggagcgggt ggtgccggac      2280
     gcgctggtgc tgaaggcgca cgcggcgctg gcggaggtcg cgccggacgt gcgggagggg      2340
     gccgtcgagc cgccggacca cgtgcgggtg ctgaccgggg cggtcgtgtc ggcggacgac      2400
     gtggtggtgc cggacctgcc gtggctgctg gcggtcctgc cgggggagca ggtgctcgcg      2460
     gcggacggcg gggcggcgga gctggcggag ctgctggagc tgccgctggc gtccgaggag      2520
     gtcgtggggt cgctgcggag cgagggcgac gaggtggtgt gggcggagct gggcgcggtg      2580
     cgcgtggcct gcgcgctgct gggcgtcgag ctgccgcggg ggaccgtggt ggtgcacgac      2640
     gagctggtgg tccacgcgga gggcgaggag cacgaggtgc cgtggtgggt ggacggggag      2700
     gtggtccacg cggcggacac cccggagggg ttggcgcggg cgctggcgtg gacgacggga      2760
     cggtgggcgg accggcacac gttcgcggcg ctgatcacgg agccgacgcc tgcggtgctg      2820
     ttggggtga                                                              2829
//

If you have problems or comments...

PBIL Back to PBIL home page