(data stored in ACNUC7421 zone)

EMBL: CP001630.PE481

CP001630.PE481       Location/Qualifiers
FT   CDS_pept        526391..527830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0488"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: acp:A2cp1_3490 xanthine/uracil/vitamin C
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34455"
FT                   /db_xref="GOA:C6WI04"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI04"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ACU34455.1"
FT                   /translation="MGLDGFFKITERGSSVGREVRGGVVTFVAMAYIVVLNPLILGSFS
FT                   ADDPSAKTDITGAILPVPQVAAVTALVAGVMTILFGLIANYPFALAAGLGINSFVAVTL
FT                   APQMTWPEAMGLVVVNGVVVLLLVLTGVRTAVFNAVPNELKAAIAVGIGLFICFIGLVD
FT                   AGFVRRIPDAAGTTVPVGLGIGGSIASWPTLVFVVGLLVTGILVARKVRGAILIGVLST
FT                   AVFSIVLEALVKAGPSAGTNPKGWNLGYPAVPDSFFSLPDLSLVGEFSFGAWTRLPALA
FT                   AALLVFTLVLTDFFDTVGTMTGLGKEGELIKEDGQLPNVSKALLVDGVGAVAGGAASAS
FT                   SNTVFIESASGIAEGARTGLANVVTGLLFLVAMFFTPLYEVIPVEAAAPALVIVGALMV
FT                   AQVKEIDFSDFSIALPAFLTIVVMPFTYSIANGIGAGFISYVLLRALTGRARSVHPLMW
FT                   GTAVAFVVYFGIGPIQALIMN"
     atgggcctgg acggcttctt caaaatcacc gagcgcgggt catccgtggg gcgcgaggtg        60
     cgcggtgggg tggtcacctt cgtcgcgatg gcctacatcg tggtcctcaa ccccctgatc       120
     ctcggcagct tctccgccga cgacccgtcc gcgaagaccg acatcaccgg cgcgatcctg       180
     cccgtcccgc aggtcgcggc ggtcaccgcg ctggtcgcgg gcgtgatgac catcctgttc       240
     ggcctgatcg cgaactaccc gttcgcgctc gccgcgggcc tgggcatcaa ctcgttcgtg       300
     gcggtcaccc tcgccccgca gatgacctgg cccgaggcga tgggcctggt cgtggtcaac       360
     ggcgtcgtgg tgctcctcct ggtgctcacc ggggtccgca cggccgtgtt caacgcggtg       420
     ccgaacgagc tgaaggccgc catcgcggtc ggcatcggcc tgttcatctg cttcatcggc       480
     ctggtcgacg ccgggttcgt gcgccgcatc ccggacgccg cgggcaccac cgtcccggtc       540
     ggcctcggca tcggcggctc gatcgcgtcc tggcccacgc tggtgttcgt ggtcggcctg       600
     ctcgtcaccg ggatcctggt cgcccgcaag gtccggggcg cgatcctgat cggcgtgctc       660
     tccaccgccg tcttctccat cgtgctggag gcgctcgtca aggcgggccc gtcggcgggc       720
     accaacccga agggctggaa cctcggctac ccggccgtgc cggacagctt cttcagcctc       780
     cccgacctgt ccctggtcgg cgagttctcg ttcggcgcct ggacccgcct gcccgcgctg       840
     gccgccgccc tgctggtgtt cacgctcgtg ctcaccgact tcttcgacac cgtgggcacc       900
     atgaccggcc tcggcaagga gggcgagctg atcaaggagg acgggcagct gcccaacgtc       960
     agcaaggccc tgctggtcga cggcgtcggc gcggtcgcgg gcggcgcggc gtcggcctcg      1020
     tcgaacaccg tgttcatcga gtccgcctcc ggtatcgccg agggcgcccg cacgggcctg      1080
     gcgaacgtgg tcaccggcct gctgttcctg gtcgcgatgt tcttcacccc gctctacgag      1140
     gtcatcccgg tcgaggcggc cgcgcccgcg ctggtgatcg tcggcgcgct gatggtcgcc      1200
     caggtcaagg agatcgactt ctccgacttc tcgatcgcgc tgcccgcgtt cctgaccatc      1260
     gtcgtcatgc cgttcaccta ctcgatcgcc aatggcatcg gcgcgggctt catcagctac      1320
     gtgctgctgc gcgcgctgac cggccgggcc cgcagcgtgc acccgctgat gtggggcacg      1380
     gcggtggcgt tcgtcgtgta cttcggcatc ggcccgatcc aggccctgat catgaactga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page