(data stored in ACNUC7421 zone)

EMBL: CP001630.PE482

CP001630.PE482       Location/Qualifiers
FT   CDS_pept        527995..528441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0489"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bvi:Bcep1808_5100 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34456"
FT                   /db_xref="GOA:C6WI05"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI05"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU34456.1"
FT                   /translation="MRYANYVAETDDHGLASRLRLAIIRLNRRLRAQRVNSTISLTQVS
FT                   ALSTLHKCGPLTPGELAAKEGVQPPSMTRVIAALEELGFATRRPHPTDGRQAIVELSPS
FT                   GMQYINAEVSAREAWLDQHLAELTPEDRAVLSRAAEIIDRMAGQ"
     gtgaggtatg ctaactacgt ggcggagacc gacgaccatg ggctggcgag caggctgagg        60
     ctcgccatca tcaggttgaa ccggaggctc cgcgcgcagc gggtcaactc cacgatctcg       120
     ctcacccagg tgtccgcgct ctccacgctg cacaagtgcg gaccgctgac gccgggcgag       180
     ctcgcggcca aggagggcgt ccagccgccg tcgatgacca gggtcatcgc cgcgctggag       240
     gagctcggct tcgccacccg caggccccac cccacggacg gccgccaggc catcgtggag       300
     ctgagcccca gcgggatgca gtacatcaac gcggaggtgt ccgccaggga ggcctggctg       360
     gaccagcacc tcgcggagtt gacacccgag gacagggcgg tgctctccag ggccgccgag       420
     atcatcgaca ggatggcggg gcagtaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page