(data stored in ACNUC7421 zone)

EMBL: CP001630.PE483

CP001630.PE483       Location/Qualifiers
FT   CDS_pept        528446..529831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0490"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: bpy:Bphyt_5813 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34457"
FT                   /db_xref="GOA:C6WI06"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI06"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34457.1"
FT                   /translation="MPAYAEGSQTDRPDRDTALPPPKRKRPGTFSSLKVRNYRLYASGQ
FT                   VVSLVGLWMQRVAQDWLVLELSGGDPVALGLAAALQFAPTLLLSLWAGVLADRLDKRRL
FT                   LLVLETGLGLCALALGLLEVLGAAELWHVYLLCLLLGAVSAVETPVRQSFVVEMVGRDQ
FT                   LTNAVALNSMTFNLARMVGPAVAGGLIVVVGGTGWVFLINAASFVAVIAGLLLMRPAEL
FT                   HRGEPVPREPGQLREGLRYVRKRPDLVILLFLVFFVSTFGLNFYVTLAVLARNTFGGDA
FT                   DAYGLLSTLLAVGTLAGATLAARRSTRGAKPRPVLLVVGALAFGVLEIVAGLMPTLWLV
FT                   GLVLIPVGVAMMTFTTTANATVQLSVTPAMRGRVMGLYMLVFLGGNPVGGPVMGWLADH
FT                   FTARAPLVVGGAVSIVAALVGALVLARRGGMPLPVVRLSRRRAGPDQAVPAAATPAAAT
FT                   PDA"
     gtgcctgctt atgcggaggg ctcgcagacc gatcgacccg atcgagacac cgcgctacct        60
     ccgcccaagc gcaagcgacc aggcacgttc agctccctga aggtccgcaa ctaccggctc       120
     tacgcctccg gccaggtcgt ctcgctggtc ggcctctgga tgcagcgcgt cgcccaggac       180
     tggctggtcc tggagctgtc cggcggcgac ccggtcgcgc tcggcctcgc cgccgccctc       240
     cagttcgccc ccaccctgct gctgtcgctg tgggcgggcg tgctcgccga ccggctcgac       300
     aagcgccgcc tgctgctcgt gctggagacc ggcctcggcc tgtgcgcgct cgcgctcggc       360
     ctgctggagg tcctcggcgc cgccgagctg tggcacgtct acctgctgtg cctgctgctc       420
     ggcgcggtgt ccgccgtgga gacgccggtg cgccagtcgt tcgtggtgga gatggtcggc       480
     cgcgaccagc tcaccaacgc ggtcgcgctc aactccatga cgttcaacct ggcccgcatg       540
     gtcggaccgg ccgtcgcggg cggcctgatc gtggtcgtcg gcggcaccgg ctgggtgttc       600
     ctgatcaacg ccgccagctt cgtcgcggtg atcgcgggcc tgctgctgat gcgccccgcc       660
     gagctgcacc ggggcgagcc ggtgcccagg gagcccggcc agctccgcga gggcctgcgc       720
     tacgtgcgca agcgcccgga cctggtgatc ctgctgttcc tggtgttctt cgtgagcacg       780
     ttcgggttga acttctacgt caccctcgcc gtgctggccc gcaacacctt cggcggcgac       840
     gccgacgcgt acgggctgct gtccacgctg ctcgcggtcg gcaccctcgc gggcgcgacg       900
     ctggccgccc ggcgcagcac gcgcggcgcg aagccgcggc cggtgctgct ggtcgtcggc       960
     gcgctggcgt tcggcgtgct ggagatcgtc gccgggctga tgcccacgct gtggctggtc      1020
     gggctggtgc tgatcccggt cggcgtggcg atgatgacct tcacgaccac cgccaacgcg      1080
     accgtgcagc tgtccgtcac gcccgccatg cgcggccggg tgatggggct ctacatgctg      1140
     gtcttcctgg gcggcaaccc ggtcggcggg cccgtcatgg gctggctggc cgaccacttc      1200
     accgcccgcg cgccgctggt ggtcggcggc gcggtctcga tcgtggccgc gctggtcggc      1260
     gcgctcgtgc tcgcccgccg gggcgggatg ccgctgcccg tggtgcggct gtcccggcgc      1320
     agggccgggc cggaccaggc cgtgcccgcc gccgccacgc ccgccgccgc cacccccgac      1380
     gcgtga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page