(data stored in ACNUC7421 zone)

EMBL: CP001630.PE484

CP001630.PE484       Location/Qualifiers
FT   CDS_pept        529828..531102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0491"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: gdi:GDI0684 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34458"
FT                   /db_xref="GOA:C6WI07"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI07"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34458.1"
FT                   /translation="MTATGAPPAPRRAGAFSSLRLRNYRLYASGQLVSLVGLWMERVAQ
FT                   DWLVLQLSGGDPIALGVATALQFGPVLALSMWAGVLADRLDKRLLLIGLQSGMAVLALV
FT                   LGLVDLSGVAQLWHVYLLCLAGGVLSAVEAPVRQSFAVEMVGREQVANAVALNSMTFNA
FT                   ARMIGPAVAGGLIVVVGTGWIFLIRAASFAGVLAGLALMRAAELHRGAPVAKARGQLAE
FT                   GLRYLRGRPDLVAVMLVVFLVGVFGLNFHVSLALLASDTFGGDADAYGLLTTTMAVGTL
FT                   AGAAMAARRSAPGPRLLVGGAAAFGVLELLSGLMPTMLTAALALIPVGAAMMTFTTTAN
FT                   STVQLAVAPGMRGRVMGVYMTVFMGSAPLSGLLTGWVADRFDARAPLVLGGAVSVLAAL
FT                   LGALVLARANRMGDTSSQNSEVRLT"
     gtgaccgcga ccggcgcgcc cccggccccg cggcgggccg gggcgttctc ctcgctgcgc        60
     ttgcgcaact accggctcta cgcctccggc cagctcgtct cgctggtcgg gctgtggatg       120
     gagcgggtcg cgcaggactg gctggtgctc cagctgtccg gcggcgaccc gatcgcgctg       180
     ggcgtggcca cggccctgca gttcggcccg gtgctggcgc tgtccatgtg ggcgggcgtg       240
     ctggccgacc ggttggacaa gcgcctgctg ctgatcggcc tccagtccgg catggcggtg       300
     ctcgcgctgg tgctcggcct ggtcgacctg tccggggtcg cgcagctgtg gcacgtgtac       360
     ctgctgtgcc tggcgggcgg cgtgctgtcc gccgtggagg ccccggtgcg gcagtcgttc       420
     gcggtggaga tggtcggccg cgagcaggtc gcgaacgcgg tcgcgctcaa ctcgatgacg       480
     ttcaacgccg cccggatgat cggcccggcc gtggcgggcg ggctgatcgt ggtggtcggc       540
     accggctgga tcttcctgat ccgcgcggcg agcttcgcgg gcgtgctggc cgggctcgcc       600
     ctgatgcggg ccgccgagct gcaccggggc gcgccggtgg ccaaggccag ggggcagctc       660
     gccgaggggc tgcgctacct gcgcggcagg ccggacctgg tcgccgtgat gctcgtggtg       720
     ttcctggtcg gcgtgttcgg gctgaacttc cacgtgtcgc tggcgctgct ggccagcgac       780
     accttcggcg gcgacgccga cgcgtacggg ctgctcacca cgaccatggc ggtgggcacg       840
     ctggcgggcg cggcgatggc ggccaggcgg tccgcgccgg ggccccggct gctggtgggc       900
     ggcgcggcgg cgttcggggt gctggagctg ctgtccgggc tgatgccgac gatgctcacg       960
     gcggcgctcg cgctgatccc ggtcggcgcg gcgatgatga cgttcacgac caccgcgaac      1020
     tcgaccgtgc agctcgccgt cgcgcccggg atgcgggggc gggtgatggg cgtttacatg      1080
     acggtgttca tggggagcgc tccgctgtcc gggctgctca ccggctgggt ggccgaccgg      1140
     ttcgacgccc gcgcgccgct ggtgctgggc ggcgcggtgt cggtgctggc cgcgctgctc      1200
     ggggcgctcg tcctggcgcg ggcgaaccgg atgggggaca cctcttccca aaacagtgaa      1260
     gttaggctaa cctaa                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page