(data stored in ACNUC7421 zone)

EMBL: CP001630.PE485

CP001630.PE485       Location/Qualifiers
FT   CDS_pept        complement(531287..531916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0492"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34459"
FT                   /db_xref="GOA:C6WI08"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI08"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ACU34459.1"
FT                   /translation="MAQYVLPDLDYDYGDLQPAIIGEINELHHSKHHAAYVKGANDTLE
FT                   QIDEARDKSAFGSIVGLETTLAFHLAGHALHQVWWKNLSPNGGDKPSGELAAAIDEHFG
FT                   SFDGLRAQLNAAAGSIQGSGWGILAWEPVGQRLITQQLKDHHSNLSIATTPLLVFDIWE
FT                   HAYYLQYRNLKADYIGALWNIVNWDDVNARFEAARAGQNGLLLPTR"
     atggcccagt acgtgttgcc ggacctggac tacgactacg gcgacctgca gccggcgatc        60
     atcggcgaga tcaacgagct gcaccacagc aagcaccacg ccgcgtacgt caagggcgcc       120
     aacgacaccc ttgagcagat cgacgaggcc agggacaaga gcgcgttcgg ctcgatcgtg       180
     ggcctggaga cgacgctggc gttccacctg gccgggcacg cgctgcacca ggtctggtgg       240
     aagaacctga gcccgaacgg cggcgacaag ccgtccggcg agctggccgc cgcgatcgac       300
     gagcacttcg gctcgttcga cggcctgcgc gcgcagctga acgccgccgc gggcagcatc       360
     cagggctcgg gctggggaat cctggcctgg gagccggtgg ggcagcggct gatcacgcag       420
     cagctgaagg accaccactc caacctgtcg atcgccacca caccgctgct ggtgttcgac       480
     atctgggagc acgcgtacta cctgcagtac cgcaacctga aggccgacta catcggcgcg       540
     ctctggaaca tcgtgaactg ggacgacgtg aacgcccggt tcgaggcggc ccgcgcgggc       600
     cagaacggcc tgctgctgcc gacgcggtag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page