(data stored in ACNUC7421 zone)

EMBL: CP001630.PE486

CP001630.PE486       Location/Qualifiers
FT   CDS_pept        532020..533633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0493"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce6528 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34460"
FT                   /db_xref="GOA:C6WI09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI09"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34460.1"
FT                   /translation="MSALAARNLSLSFGPRTVLSEVDLDVPAGERVGLVAPNGVGKSTL
FT                   LKVLAGELTPERGTVTASGPVAHLTQETAVEPGESLRDHLARRTGVADAEAAFERAAQA
FT                   LAEGAPGAEDAYATAFDRWTAVGAGDFAERADEVCQRLGLPADLLDARGSGELSGGQSA
FT                   RLRLASVLLVRADVLLLDEPTNDLDADGLELLEAHVLGTRAAVVLVSHDREFLSRTITA
FT                   VAELDEFTHGLTAFGGGWDAYLAERDAAARRAQEDYDEYAAKKDALTRRARTAKEWSRA
FT                   GVRRNAKSDERDKFIKFFAKQGAENTAGKGAAADRALERLEEVEEPRKPWELRLTLPAA
FT                   SGGSRVAFTLRGAVVSRGDVTLGPVDLTIGAGERWRLTGPNGSGKSTLLGAILGRVPLD
FT                   AGERSEGSVVVGEIDQVRGAFSGATPVLDVVVAATGLAEAEARTLLAKFRVGADVVLRP
FT                   AGTLSPGERTRAALALLQARGTTCLVLDEPTNHLDLAAIEQLEQALAEYAGTVLLITHD
FT                   RRLATSVGVDHALDVRSLAR"
     gtgtccgctc tggcagcaag gaacctgtcg ctgtcgttcg gtccgaggac cgtgctctcg        60
     gaggttgatc tcgatgttcc agcaggcgag cgcgtaggcc tggtcgcccc caacggggtc       120
     ggcaagtcca cgctgctgaa ggtgctcgcg ggcgagctga cgcccgagcg ggggacggtc       180
     accgcctccg ggcccgtggc ccacctcacc caggagaccg cggtcgagcc gggcgagtcg       240
     ctgcgcgacc acttggcccg ccgcaccggc gtcgccgacg ccgaggccgc gttcgagcgc       300
     gccgcgcagg ccctcgccga gggcgcgccc ggagccgagg acgcctacgc gacggccttc       360
     gaccgctgga ccgccgtcgg cgcgggcgac ttcgccgagc gcgccgacga ggtgtgccag       420
     cggctcgggc tgcccgccga cctgctcgac gcgcgcggct ccggcgagct gtccggcggc       480
     cagtccgccc ggctgcggct cgcctcggtg ctgctcgtgc gcgccgacgt gctgctgctc       540
     gacgagccca ccaacgacct ggacgcggac ggcctggaac tgctggaggc ccacgtcctc       600
     ggcacgcgcg cggccgtcgt cctggtcagc cacgaccggg agttcctgtc ccgcacgatc       660
     accgccgtgg ccgagctgga cgagttcacc cacgggctga ccgcgttcgg cggcggctgg       720
     gacgcctacc tcgccgagcg cgacgccgcc gcccggcgcg cgcaggagga ctacgacgag       780
     tacgcggcga agaaggacgc cctgacccgc cgcgcccgca ccgccaagga gtggtcccgc       840
     gcgggcgtgc ggcgcaacgc caagtccgac gagcgcgaca agttcatcaa gttcttcgcc       900
     aagcagggcg cggagaacac cgcgggcaag ggcgcggcgg ccgaccgcgc gctggagcgg       960
     ctggaggagg tcgaggagcc ccgcaagccg tgggagctgc ggctgaccct gcccgccgcg      1020
     agcggtggca gccgggtcgc gttcaccctg cgcggcgcgg tcgtctcgcg cggggacgtc      1080
     accctcggcc cggtcgacct gaccatcggc gcgggcgagc gctggcgcct caccggcccc      1140
     aacggctccg gcaagtccac cctgctcggg gcgatcctcg gccgcgtccc gctggacgcg      1200
     ggggagcggt ccgagggcag cgtcgtggtc ggcgagatcg accaggtgcg cggcgcgttc      1260
     agcggggcca ccccggtgct ggacgtggtc gtggcggcca ccgggctggc cgaggccgag      1320
     gccaggacgc tgctggccaa gttccgggtc ggcgcggacg tcgtgctccg gcccgccggg      1380
     accctctcgc ccggcgagcg caccagggcc gcgctcgcgc tcctgcaggc caggggcacc      1440
     acctgcctgg tgctggacga gccgaccaac cacctcgacc tcgccgccat cgagcagctg      1500
     gagcaggcgc tcgccgagta cgccgggacc gtgctgctga tcacccacga ccgccgtctc      1560
     gccacgtcgg tcggggtgga ccacgcgctc gacgtccgga gcctggcaag atga            1614
//

If you have problems or comments...

PBIL Back to PBIL home page