(data stored in ACNUC7421 zone)

EMBL: CP001630.PE487

CP001630.PE487       Location/Qualifiers
FT   CDS_pept        533638..534048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34461"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34461.1"
FT                   /translation="MGTEEDWPVEQTWSMRNTHWHAYVEHTSLDSASPRAERLERAPEE
FT                   VLTTPTEVAAWLEVNLRSATKPEETGKKRAKDERDFSDSHRVHVSLASRGESIYTGVKG
FT                   MLTLAVEAVTPDDCRSSHDGADVAPLKAGRRR"
     atgggcaccg aggaggactg gccggtagag cagacgtggt cgatgcgcaa cacgcactgg        60
     cacgcctacg tcgagcacac ctcgctcgac agcgcctcac cgcgcgccga acgcctggag       120
     cgcgcgcccg aggaggtgct caccacgccg accgaggtcg ccgcctggct ggaggtcaac       180
     ctccgcagcg ccaccaagcc cgaggagacc ggcaagaagc gcgccaagga cgagcgcgac       240
     ttctccgact cgcaccgggt gcacgtctcg ctggcctcgc gcggcgagtc gatctacacc       300
     ggggtgaagg ggatgctgac cctcgcggtc gaggcggtca cccccgacga ctgccgcagc       360
     tcgcacgacg gggccgacgt cgccccgctg aaggcgggcc gccgccgcta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page