(data stored in ACNUC7421 zone)

EMBL: CP001630.PE488

CP001630.PE488       Location/Qualifiers
FT   CDS_pept        complement(534080..535573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0495"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   scl:sce0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34462"
FT                   /db_xref="GOA:C6WI11"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR016602"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI11"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ACU34462.1"
FT                   /translation="MGRDVSTRTFTGEDRRHYRERVQRCLDALGTMLAEDCFSFPRQQM
FT                   GLEIELNLADRAGLPAMRNAEVLEKIDDPAFTLELGQHNLELNVPPRELAGDHTLGLER
FT                   DLRALLGVADAKAQDAGASLVMIGVLPTLRPEHFDRRWLSHNPRYSLLNDQIFAARGEE
FT                   LVLSLEGAPLPGRDAERLLSRSESILPEAACTSVQLHLQVAPEDFAAHWNAAQCLAGVQ
FT                   VAIAANSPFLLGRALWHETRIPLFQQATDTRPQELQNQGVRPRVWFGERWITSIFDLFE
FT                   ENVRYFPALLPETGDEDPVDVLGSGGTPRMTELRLHNGTVWRWNRPVYDVVAGVPHLRI
FT                   ENRVLPAGPTVLDTLANAAFFYGAQRALSSMDRPLWTQMSFQAAEENLYAGARHGMNAQ
FT                   LYWPGIGWVPPDELVLRRLLPLAHEGLRDCGVSDEARERYLGVIEARCLAGRTGALWQR
FT                   EVVAGLEERGAGREGALAGMLARYVERMHEGEPVHTWSV"
     atgggtaggg acgtgtccac tcggacgttc accggagaag accgcaggca ctaccgcgag        60
     cgggtccagc gctgcctgga cgcgctgggc acgatgctcg ccgaggactg cttctcgttc       120
     ccccgccagc agatgggcct ggagatcgag ctgaacctcg ccgaccgcgc cggactgccc       180
     gcgatgcgca acgccgaggt cctggagaag atcgacgacc cggcgttcac cctggagctg       240
     ggccagcaca acctggagct gaacgtcccc ccgcgcgagc tggccggtga ccacaccctg       300
     ggcctggagc gcgacctgag ggcgctgctc ggcgtcgcgg acgccaaggc gcaggacgcg       360
     ggggcgagcc tggtgatgat cggggtgctg ccgacgctgc gccccgagca cttcgaccgc       420
     cgctggctct cgcacaaccc gcgctactcg ctgctcaacg accagatctt cgccgcgcgg       480
     ggcgaggagc tggtgctgtc gctggagggc gcgccgctgc cggggcggga cgcggagcgg       540
     ctgctcagcc gcagcgagtc gatcctgccg gaggccgcct gcacatcggt gcagctgcac       600
     ctgcaggtcg cgccggagga cttcgcggcg cactggaacg ccgcgcagtg cctggcgggc       660
     gtgcaggtgg cgatcgcggc gaactcgccg ttcctgctgg gcagggcgct gtggcacgag       720
     acccgcatcc cgctgttcca gcaggccacc gacacccggc cgcaggagct gcagaaccag       780
     ggcgtgcggc cgagggtgtg gttcggggag cggtggatca cctcgatctt cgacctgttc       840
     gaggagaacg tccgctactt ccccgcgctg ctgccggaga ccggcgacga ggacccggtg       900
     gacgtgctcg gctccggcgg cacgccgagg atgacggagc tgcggctgca caacggcacg       960
     gtgtggcggt ggaaccggcc ggtgtacgac gtggtggccg gggtgccgca cctgcggatc      1020
     gagaaccggg tgctgcccgc cggtccgacc gtgctggaca cgctcgcgaa cgcggcgttc      1080
     ttctacggcg cgcagcgggc gctgtcctcg atggaccgtc cgctgtggac gcagatgtcg      1140
     ttccaggcgg cggaggagaa cctctacgcg ggcgccaggc acggcatgaa cgcccagctg      1200
     tactggcccg gcatcggctg ggtcccgccc gacgagctgg tgctgcgccg cctcctcccg      1260
     ctggcccacg aggggctgcg cgactgcggg gtgtccgacg aggcgcggga gcgctacctc      1320
     ggcgtgatcg aggcgcgctg cctggccggg cggacggggg cgctgtggca gcgggaggtc      1380
     gtcgccggcc tggaggagcg cggcgcgggc cgcgaggggg cgctggccgg gatgctggcc      1440
     aggtacgtgg agcggatgca cgagggggag ccggtgcaca cctggtcggt gtga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page